Citrus Sinensis ID: 030234

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAEKPPQEVTSEVQKALSA
cHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHcccEEEEcccccHHHHHHHHHHHHcc
HHHHHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHcccEEEEcccccHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHccEEccccccEEEcccEccccccEccccccEcEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHc
MLRAAVAAktplgikakeamdkgelvsdDLVVGIIDEamkkpscqkgfildgfprteVQAQKLDEMLEKQGKKVDKVLNFAIDDAvleeritgrwihpssgrtyhtkfappkvpgvddvtgepliqrkDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIvaqlhaekppqeVTSEVQKALSA
mlraavaaktplgikakeamdkgelvSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEkqgkkvdkVLNFAIDDavleeritgrwihpssgrtyhtkfappkvpgvddVTGEPLIQRKDDTAAVLKSRLEafhkqtepvIDYYSKKGIVAQLHaekppqevtsEVQKALSA
MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAEKPPQEVTSEVQKALSA
***********************ELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQ***********GKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFA******V**V****LI*****TAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQ********************
MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAEKPPQEVTSEVQKALSA
MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAE****************
MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAEKPPQEVTSEVQKALSA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAEKPPQEVTSEVQKALSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query181 2.2.26 [Sep-21-2011]
Q08480243 Adenylate kinase B OS=Ory yes no 0.994 0.740 0.922 1e-94
Q08479241 Adenylate kinase A OS=Ory no no 0.994 0.746 0.916 4e-93
O82514246 Adenylate kinase 1 OS=Ara yes no 0.994 0.731 0.816 1e-85
Q9FK35248 Adenylate kinase 2 OS=Ara no no 0.939 0.685 0.811 4e-80
Q74ZL1277 Adenylate kinase 1 OS=Ash yes no 0.988 0.646 0.572 3e-55
B4KLY1240 Adenylate kinase 2, mitoc N/A no 0.966 0.729 0.565 8e-55
Q9U915240 Adenylate kinase 2, mitoc yes no 0.966 0.729 0.56 5e-54
Q54QJ9276 Adenylate kinase 2, mitoc yes no 0.917 0.601 0.590 7e-54
B3MCQ5240 Adenylate kinase 2, mitoc N/A no 0.966 0.729 0.554 1e-53
B4PAR6240 Adenylate kinase 2, mitoc N/A no 0.966 0.729 0.554 2e-53
>sp|Q08480|KAD2_ORYSJ Adenylate kinase B OS=Oryza sativa subsp. japonica GN=ADK-B PE=2 SV=1 Back     alignment and function desciption
 Score =  344 bits (883), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 174/180 (96%)

Query: 1   MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQA 60
           MLRAAVAAKTPLG+KAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRT VQA
Sbjct: 64  MLRAAVAAKTPLGVKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTVVQA 123

Query: 61  QKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVT 120
           QKLDEMLEK+G KVDKVLNFAIDD++LEERITGRWIHPSSGR+YHTKFAPPKVPGVDDVT
Sbjct: 124 QKLDEMLEKKGTKVDKVLNFAIDDSILEERITGRWIHPSSGRSYHTKFAPPKVPGVDDVT 183

Query: 121 GEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAEKPPQEVTSEVQKALS 180
           GEPLIQRKDDTA VLKSRLEAFHKQTEPVIDYYSKK +VA LHAEKPP+EVT+EVQK LS
Sbjct: 184 GEPLIQRKDDTAEVLKSRLEAFHKQTEPVIDYYSKKALVANLHAEKPPKEVTAEVQKVLS 243
This small ubiquitous enzyme is essential for maintenance and cell growth.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 3
>sp|Q08479|KAD1_ORYSJ Adenylate kinase A OS=Oryza sativa subsp. japonica GN=ADK-A PE=2 SV=1 Back     alignment and function description
>sp|O82514|KAD1_ARATH Adenylate kinase 1 OS=Arabidopsis thaliana GN=ADK1 PE=2 SV=2 Back     alignment and function description
>sp|Q9FK35|KAD2_ARATH Adenylate kinase 2 OS=Arabidopsis thaliana GN=ADK2 PE=2 SV=1 Back     alignment and function description
>sp|Q74ZL1|KAD1_ASHGO Adenylate kinase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ADK1 PE=3 SV=1 Back     alignment and function description
>sp|B4KLY1|KAD2_DROMO Adenylate kinase 2, mitochondrial OS=Drosophila mojavensis GN=Adk2 PE=3 SV=1 Back     alignment and function description
>sp|Q9U915|KAD2_DROME Adenylate kinase 2, mitochondrial OS=Drosophila melanogaster GN=Adk2 PE=1 SV=1 Back     alignment and function description
>sp|Q54QJ9|KAD2_DICDI Adenylate kinase 2, mitochondrial OS=Dictyostelium discoideum GN=adkA PE=3 SV=1 Back     alignment and function description
>sp|B3MCQ5|KAD2_DROAN Adenylate kinase 2, mitochondrial OS=Drosophila ananassae GN=Adk2 PE=3 SV=1 Back     alignment and function description
>sp|B4PAR6|KAD2_DROYA Adenylate kinase 2, mitochondrial OS=Drosophila yakuba GN=Adk2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
255547804242 adenylate kinase 1, putative [Ricinus co 1.0 0.747 0.917 3e-93
357477153243 Adenylate kinase B [Medicago truncatula] 0.994 0.740 0.927 3e-93
307136105207 adenylate kinase [Cucumis melo subsp. me 1.0 0.874 0.917 7e-93
115485231243 Os11g0312400 [Oryza sativa Japonica Grou 0.994 0.740 0.922 7e-93
225456268245 PREDICTED: adenylate kinase B [Vitis vin 1.0 0.738 0.917 1e-92
356513991242 PREDICTED: adenylate kinase B-like [Glyc 0.994 0.743 0.927 1e-92
449469623247 PREDICTED: adenylate kinase B-like [Cucu 1.0 0.732 0.911 3e-92
224136089248 predicted protein [Populus trichocarpa] 1.0 0.729 0.911 3e-92
357160378241 PREDICTED: adenylate kinase A-like [Brac 0.994 0.746 0.911 1e-91
115487950241 Os12g0236400 [Oryza sativa Japonica Grou 0.994 0.746 0.916 2e-91
>gi|255547804|ref|XP_002514959.1| adenylate kinase 1, putative [Ricinus communis] gi|223546010|gb|EEF47513.1| adenylate kinase 1, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  346 bits (887), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 166/181 (91%), Positives = 177/181 (97%)

Query: 1   MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQA 60
           MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGF+LDGFPRT VQA
Sbjct: 62  MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFVLDGFPRTVVQA 121

Query: 61  QKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVT 120
           Q+LDEMLEKQG KVDKVL+FAIDD++LEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVT
Sbjct: 122 QRLDEMLEKQGTKVDKVLDFAIDDSILEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVT 181

Query: 121 GEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAEKPPQEVTSEVQKALS 180
           GEPLIQRKDDT AVLKSRLEAFHKQTEPVIDYY+KKG++AQLHAEKPP+EVT+EVQK LS
Sbjct: 182 GEPLIQRKDDTPAVLKSRLEAFHKQTEPVIDYYAKKGVLAQLHAEKPPKEVTAEVQKVLS 241

Query: 181 A 181
           +
Sbjct: 242 S 242

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357477153|ref|XP_003608862.1| Adenylate kinase B [Medicago truncatula] gi|217075582|gb|ACJ86151.1| unknown [Medicago truncatula] gi|355509917|gb|AES91059.1| Adenylate kinase B [Medicago truncatula] gi|388515225|gb|AFK45674.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|307136105|gb|ADN33951.1| adenylate kinase [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|115485231|ref|NP_001067759.1| Os11g0312400 [Oryza sativa Japonica Group] gi|585338|sp|Q08480.1|KAD2_ORYSJ RecName: Full=Adenylate kinase B; Short=AK B; AltName: Full=ATP-AMP transphosphorylase B gi|391879|dbj|BAA01181.1| adenylate kinase-b [Oryza sativa] gi|62734015|gb|AAX96124.1| adenylate kinase b (ec 2.7.4.3) (atp-amp transphosphorylase) [Oryza sativa Japonica Group] gi|77550163|gb|ABA92960.1| Adenylate kinase B, putative, expressed [Oryza sativa Japonica Group] gi|113644981|dbj|BAF28122.1| Os11g0312400 [Oryza sativa Japonica Group] gi|125534192|gb|EAY80740.1| hypothetical protein OsI_35920 [Oryza sativa Indica Group] gi|125576978|gb|EAZ18200.1| hypothetical protein OsJ_33744 [Oryza sativa Japonica Group] gi|215707086|dbj|BAG93546.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|225456268|ref|XP_002283508.1| PREDICTED: adenylate kinase B [Vitis vinifera] gi|297734386|emb|CBI15633.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356513991|ref|XP_003525691.1| PREDICTED: adenylate kinase B-like [Glycine max] gi|356513993|ref|XP_003525692.1| PREDICTED: adenylate kinase B-like [Glycine max] gi|255637862|gb|ACU19250.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449469623|ref|XP_004152518.1| PREDICTED: adenylate kinase B-like [Cucumis sativus] gi|449521377|ref|XP_004167706.1| PREDICTED: adenylate kinase B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224136089|ref|XP_002322237.1| predicted protein [Populus trichocarpa] gi|118483341|gb|ABK93572.1| unknown [Populus trichocarpa] gi|222869233|gb|EEF06364.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357160378|ref|XP_003578745.1| PREDICTED: adenylate kinase A-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|115487950|ref|NP_001066462.1| Os12g0236400 [Oryza sativa Japonica Group] gi|585337|sp|Q08479.1|KAD1_ORYSJ RecName: Full=Adenylate kinase A; Short=AK A; AltName: Full=ATP-AMP transphosphorylase A gi|391877|dbj|BAA01180.1| adenylate kinase-a [Oryza sativa] gi|77554109|gb|ABA96905.1| Adenylate kinase A, putative, expressed [Oryza sativa Japonica Group] gi|113648969|dbj|BAF29481.1| Os12g0236400 [Oryza sativa Japonica Group] gi|125536202|gb|EAY82690.1| hypothetical protein OsI_37905 [Oryza sativa Indica Group] gi|125578925|gb|EAZ20071.1| hypothetical protein OsJ_35671 [Oryza sativa Japonica Group] gi|215697656|dbj|BAG91650.1| unnamed protein product [Oryza sativa Japonica Group] gi|215765406|dbj|BAG87103.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
UNIPROTKB|Q08480243 ADK-B "Adenylate kinase B" [Or 0.994 0.740 0.922 4.3e-86
UNIPROTKB|Q08479241 ADK-A "Adenylate kinase A" [Or 0.994 0.746 0.916 1.3e-84
TAIR|locus:2167316246 ADK1 "adenylate kinase 1" [Ara 0.994 0.731 0.816 6.2e-78
TAIR|locus:2177527248 AT5G50370 [Arabidopsis thalian 0.994 0.725 0.794 3.5e-75
FB|FBgn0022708240 Adk2 "Adenylate kinase-2" [Dro 0.966 0.729 0.56 3.6e-50
DICTYBASE|DDB_G0283805276 adkA "adenylate kinase" [Dicty 0.972 0.637 0.562 7.4e-50
UNIPROTKB|I3LSI3247 AK2 "Uncharacterized protein" 0.994 0.728 0.527 6e-48
MGI|MGI:87978239 Ak2 "adenylate kinase 2" [Mus 0.994 0.753 0.522 7.7e-48
SGD|S000002634222 ADK1 "Adenylate kinase, requir 0.988 0.806 0.533 1.2e-47
UNIPROTKB|P08166241 AK2 "Adenylate kinase 2, mitoc 0.994 0.746 0.516 2.6e-47
UNIPROTKB|Q08480 ADK-B "Adenylate kinase B" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 861 (308.1 bits), Expect = 4.3e-86, P = 4.3e-86
 Identities = 166/180 (92%), Positives = 174/180 (96%)

Query:     1 MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQA 60
             MLRAAVAAKTPLG+KAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRT VQA
Sbjct:    64 MLRAAVAAKTPLGVKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTVVQA 123

Query:    61 QKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVT 120
             QKLDEMLEK+G KVDKVLNFAIDD++LEERITGRWIHPSSGR+YHTKFAPPKVPGVDDVT
Sbjct:   124 QKLDEMLEKKGTKVDKVLNFAIDDSILEERITGRWIHPSSGRSYHTKFAPPKVPGVDDVT 183

Query:   121 GEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAEKPPQEVTSEVQKALS 180
             GEPLIQRKDDTA VLKSRLEAFHKQTEPVIDYYSKK +VA LHAEKPP+EVT+EVQK LS
Sbjct:   184 GEPLIQRKDDTAEVLKSRLEAFHKQTEPVIDYYSKKALVANLHAEKPPKEVTAEVQKVLS 243
GO:0004017 "adenylate kinase activity" evidence=IGI;ISS
GO:0005524 "ATP binding" evidence=IGI
GO:0006163 "purine nucleotide metabolic process" evidence=IEP
UNIPROTKB|Q08479 ADK-A "Adenylate kinase A" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2167316 ADK1 "adenylate kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177527 AT5G50370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0022708 Adk2 "Adenylate kinase-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283805 adkA "adenylate kinase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|I3LSI3 AK2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:87978 Ak2 "adenylate kinase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
SGD|S000002634 ADK1 "Adenylate kinase, required for purine metabolism" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|P08166 AK2 "Adenylate kinase 2, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q28F55KAD2_XENTR2, ., 7, ., 4, ., 30.51110.99440.7468yesno
B2B0E2KAD1_PODAN2, ., 7, ., 4, ., 30.54060.94470.6195yesno
Q9WTP6KAD2_MOUSE2, ., 7, ., 4, ., 30.52220.99440.7531yesno
P29410KAD2_RAT2, ., 7, ., 4, ., 30.51110.99440.7531yesno
A6ZYI0KAD1_YEAS72, ., 7, ., 4, ., 30.53030.99440.8108N/Ano
Q9U915KAD2_DROME2, ., 7, ., 4, ., 30.560.96680.7291yesno
Q7QJX9KAD2_ANOGA2, ., 7, ., 4, ., 30.53140.96680.7291yesno
Q6CK57KAD1_KLULA2, ., 7, ., 4, ., 30.54440.98890.7885yesno
Q5REI7KAD2_PONAB2, ., 7, ., 4, ., 30.51660.99440.7531yesno
Q6FM32KAD1_CANGA2, ., 7, ., 4, ., 30.54140.99440.8108yesno
P08166KAD2_BOVIN2, ., 7, ., 4, ., 30.51660.99440.7468yesno
A3LV51KAD1_PICST2, ., 7, ., 4, ., 30.51930.99440.7228yesno
P33075KAD1_SCHPO2, ., 7, ., 4, ., 30.53400.96680.7954yesno
Q08479KAD1_ORYSJ2, ., 7, ., 4, ., 30.91660.99440.7468nono
P54819KAD2_HUMAN2, ., 7, ., 4, ., 30.51660.99440.7531yesno
A7THY5KAD1_VANPO2, ., 7, ., 4, ., 30.52480.99440.8071N/Ano
Q08480KAD2_ORYSJ2, ., 7, ., 4, ., 30.92220.99440.7407yesno
B3LG61KAD1_YEAS12, ., 7, ., 4, ., 30.53030.99440.8108N/Ano
Q54QJ9KAD2_DICDI2, ., 7, ., 4, ., 30.59030.91710.6014yesno
P07170KAD1_YEAST2, ., 7, ., 4, ., 30.53030.99440.8108yesno
O82514KAD1_ARATH2, ., 7, ., 4, ., 30.81660.99440.7317yesno
Q290A8KAD2_DROPS2, ., 7, ., 4, ., 30.52840.97230.7333yesno
Q74ZL1KAD1_ASHGO2, ., 7, ., 4, ., 30.57220.98890.6462yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.40.976
3rd Layer2.7.4.30.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
4350358
adenylate kinase, putative, expressed; This small ubiquitous enzyme is essential for maintenance and cell growth (243 aa)
(Oryza sativa Japonica)
Predicted Functional Partners:
4345097
preprotein translocase subunit secY, putative, expressed; Involved in protein export. Probably [...] (556 aa)
•  •  • 0.908
4343303
expressed protein (163 aa)
      • 0.861
4334651
ribosomal L18p/L5e family protein, putative, expressed; Binds 5S rRNA, forms part of the centra [...] (170 aa)
•  •  • 0.787
4332089
50S ribosomal protein L15, chloroplast precursor, putative, expressed (263 aa)
•     • 0.773
4333233
ribosomal protein, putative, expressed (326 aa)
•  •    0.763
4345370
ribosomal protein S17, putative, expressed (107 aa)
•  •  • 0.742
OsI_13197
ribosomal protein S13p/S18e, putative, expressed (171 aa)
•     • 0.720
4336948
peptidase, M24 family protein, putative, expressed; Removes the amino-terminal methionine from [...] (340 aa)
•     • 0.719
4345238
50S ribosomal protein L15, putative, expressed (295 aa)
•     • 0.717
4331459
ribosomal protein L5, putative, expressed; Binds 5S rRNA, forms part of the central protuberanc [...] (279 aa)
•  •    0.711

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
PLN02674244 PLN02674, PLN02674, adenylate kinase 1e-129
PRK00279215 PRK00279, adk, adenylate kinase; Reviewed 9e-92
TIGR01351210 TIGR01351, adk, adenylate kinase 5e-85
pfam00406186 pfam00406, ADK, Adenylate kinase 9e-85
cd01428194 cd01428, ADK, Adenylate kinase (ADK) catalyzes the 6e-72
PRK02496184 PRK02496, adk, adenylate kinase; Provisional 3e-45
COG0563178 COG0563, Adk, Adenylate kinase and related kinases 5e-44
PRK14530215 PRK14530, PRK14530, adenylate kinase; Provisional 4e-39
PRK14532188 PRK14532, PRK14532, adenylate kinase; Provisional 3e-37
PRK14528186 PRK14528, PRK14528, adenylate kinase; Provisional 3e-36
PRK14526211 PRK14526, PRK14526, adenylate kinase; Provisional 5e-36
PRK13808 333 PRK13808, PRK13808, adenylate kinase; Provisional 2e-33
PRK14531183 PRK14531, PRK14531, adenylate kinase; Provisional 4e-33
PLN02842 505 PLN02842, PLN02842, nucleotide kinase 1e-32
PRK14527191 PRK14527, PRK14527, adenylate kinase; Provisional 5e-26
PTZ00088229 PTZ00088, PTZ00088, adenylate kinase 1; Provisiona 2e-25
PLN02459261 PLN02459, PLN02459, probable adenylate kinase 1e-23
TIGR01360188 TIGR01360, aden_kin_iso1, adenylate kinase, isozym 1e-21
PRK14529223 PRK14529, PRK14529, adenylate kinase; Provisional 2e-21
pfam0519136 pfam05191, ADK_lid, Adenylate kinase, active site 2e-19
TIGR01359183 TIGR01359, UMP_CMP_kin_fam, UMP-CMP kinase family 5e-18
PLN02200234 PLN02200, PLN02200, adenylate kinase family protei 4e-09
>gnl|CDD|178279 PLN02674, PLN02674, adenylate kinase Back     alignment and domain information 
 Score =  361 bits (927), Expect = e-129
 Identities = 170/180 (94%), Positives = 176/180 (97%)

Query: 1   MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQA 60
           MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRT VQA
Sbjct: 65  MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTVVQA 124

Query: 61  QKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVT 120
           QKLDEML KQG K+DKVLNFAIDDA+LEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVT
Sbjct: 125 QKLDEMLAKQGAKIDKVLNFAIDDAILEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVT 184

Query: 121 GEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAEKPPQEVTSEVQKALS 180
           GEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYY+KKG+VA LHAEKPP+EVT+EVQKALS
Sbjct: 185 GEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYAKKGVVANLHAEKPPKEVTAEVQKALS 244

Length = 244
>gnl|CDD|234711 PRK00279, adk, adenylate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|233369 TIGR01351, adk, adenylate kinase Back     alignment and domain information
>gnl|CDD|201213 pfam00406, ADK, Adenylate kinase Back     alignment and domain information
>gnl|CDD|238713 cd01428, ADK, Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>gnl|CDD|179433 PRK02496, adk, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|223637 COG0563, Adk, Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|237747 PRK14530, PRK14530, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184729 PRK14532, PRK14532, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172994 PRK14528, PRK14528, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172992 PRK14526, PRK14526, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172997 PRK14531, PRK14531, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|178435 PLN02842, PLN02842, nucleotide kinase Back     alignment and domain information
>gnl|CDD|237745 PRK14527, PRK14527, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|240262 PTZ00088, PTZ00088, adenylate kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|215253 PLN02459, PLN02459, probable adenylate kinase Back     alignment and domain information
>gnl|CDD|130427 TIGR01360, aden_kin_iso1, adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>gnl|CDD|237746 PRK14529, PRK14529, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|218488 pfam05191, ADK_lid, Adenylate kinase, active site lid Back     alignment and domain information
>gnl|CDD|130426 TIGR01359, UMP_CMP_kin_fam, UMP-CMP kinase family Back     alignment and domain information
>gnl|CDD|215125 PLN02200, PLN02200, adenylate kinase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 181
PLN02674244 adenylate kinase 100.0
PRK14529223 adenylate kinase; Provisional 100.0
PRK14526211 adenylate kinase; Provisional 100.0
PLN02459261 probable adenylate kinase 100.0
PRK00279215 adk adenylate kinase; Reviewed 100.0
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 100.0
KOG3078235 consensus Adenylate kinase [Nucleotide transport a 100.0
PTZ00088229 adenylate kinase 1; Provisional 100.0
PRK14530215 adenylate kinase; Provisional 100.0
KOG3079195 consensus Uridylate kinase/adenylate kinase [Nucle 100.0
PLN02842 505 nucleotide kinase 100.0
PRK13808 333 adenylate kinase; Provisional 100.0
PRK14528186 adenylate kinase; Provisional 100.0
PRK14531183 adenylate kinase; Provisional 100.0
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 100.0
PRK14532188 adenylate kinase; Provisional 100.0
PRK02496184 adk adenylate kinase; Provisional 100.0
PRK14527191 adenylate kinase; Provisional 100.0
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 99.97
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 99.97
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 99.97
PLN02200234 adenylate kinase family protein 99.96
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 99.92
PRK13974212 thymidylate kinase; Provisional 99.65
PF0519136 ADK_lid: Adenylate kinase, active site lid; InterP 99.15
PRK13973213 thymidylate kinase; Provisional 99.14
PRK08356195 hypothetical protein; Provisional 99.0
PRK01184184 hypothetical protein; Provisional 98.72
PRK13975196 thymidylate kinase; Provisional 98.66
PRK08233182 hypothetical protein; Provisional 98.65
PHA02530 300 pseT polynucleotide kinase; Provisional 98.53
PRK03839180 putative kinase; Provisional 98.51
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 98.39
PRK06217183 hypothetical protein; Validated 98.38
PRK00698205 tmk thymidylate kinase; Validated 98.35
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 98.3
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 98.19
PRK07933213 thymidylate kinase; Validated 98.19
PLN02924220 thymidylate kinase 98.11
KOG3327208 consensus Thymidylate kinase/adenylate kinase [Nuc 97.99
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 97.82
PRK08118167 topology modulation protein; Reviewed 97.81
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 97.72
PRK13976209 thymidylate kinase; Provisional 97.57
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 97.55
PRK14738206 gmk guanylate kinase; Provisional 97.51
PRK03731171 aroL shikimate kinase II; Reviewed 97.46
PRK13949169 shikimate kinase; Provisional 97.32
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.02
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 97.0
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 96.87
PRK14731208 coaE dephospho-CoA kinase; Provisional 96.82
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 96.79
PRK04040188 adenylate kinase; Provisional 96.77
PRK06762166 hypothetical protein; Provisional 96.33
COG1936180 Predicted nucleotide kinase (related to CMP and AM 96.32
PF01712146 dNK: Deoxynucleoside kinase; InterPro: IPR002624 T 96.28
PRK12339197 2-phosphoglycerate kinase; Provisional 96.19
PRK09825176 idnK D-gluconate kinase; Provisional 96.12
PRK14734200 coaE dephospho-CoA kinase; Provisional 95.51
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.46
PRK00081194 coaE dephospho-CoA kinase; Reviewed 95.07
PRK07261171 topology modulation protein; Provisional 95.02
PRK00300205 gmk guanylate kinase; Provisional 94.93
PRK13947171 shikimate kinase; Provisional 94.53
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 94.3
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 94.28
PRK00131175 aroK shikimate kinase; Reviewed 94.22
TIGR00152188 dephospho-CoA kinase. This model produces scores i 94.16
PRK05057172 aroK shikimate kinase I; Reviewed 94.06
COG0703172 AroK Shikimate kinase [Amino acid transport and me 93.73
PRK11545163 gntK gluconate kinase 1; Provisional 93.33
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 93.32
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 92.77
PRK14737186 gmk guanylate kinase; Provisional 92.67
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 92.34
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 92.2
PRK14732196 coaE dephospho-CoA kinase; Provisional 91.94
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 91.42
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 91.18
PRK13946184 shikimate kinase; Provisional 91.09
PRK14730195 coaE dephospho-CoA kinase; Provisional 90.91
PTZ00451244 dephospho-CoA kinase; Provisional 90.56
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 90.49
PLN02422232 dephospho-CoA kinase 89.91
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 89.3
PRK04182180 cytidylate kinase; Provisional 89.12
PHA03132580 thymidine kinase; Provisional 89.06
KOG4235244 consensus Mitochondrial thymidine kinase 2/deoxygu 88.72
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 88.56
PF03668 284 ATP_bind_2: P-loop ATPase protein family; InterPro 88.5
PRK14733204 coaE dephospho-CoA kinase; Provisional 88.36
TIGR03707230 PPK2_P_aer polyphosphate kinase 2, PA0141 family. 86.76
COG1660 286 Predicted P-loop-containing kinase [General functi 86.67
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 86.5
PRK08154309 anaerobic benzoate catabolism transcriptional regu 86.4
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 86.13
TIGR03709264 PPK2_rel_1 polyphosphate:nucleotide phosphotransfe 85.23
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 85.05
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 84.82
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 84.79
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 84.03
PRK00625173 shikimate kinase; Provisional 83.83
PRK12496164 hypothetical protein; Provisional 83.43
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 82.21
PRK05480209 uridine/cytidine kinase; Provisional 82.21
TIGR00235207 udk uridine kinase. Model contains a number of lon 82.04
COG3709192 Uncharacterized component of phosphonate metabolis 81.2
>PLN02674 adenylate kinase Back     alignment and domain information 
Probab=100.00  E-value=2.4e-51  Score=323.69  Aligned_cols=180  Identities=94%  Similarity=1.364  Sum_probs=175.1

Q ss_pred             ChhHHHhcCChHHHHHHHHHHCCCCCCHHHHHHHHHHHHcCCCCCCCeEecCCCCCHHHHHHHHHHHHhcCCCccEEEEe
Q 030234            1 MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEKQGKKVDKVLNF   80 (181)
Q Consensus         1 llr~~i~~~t~lg~~i~~~l~~G~~vpd~~v~~ll~~~l~~~~~~~G~iLdGfPrt~~Qa~~l~~~l~~~~~~p~~vi~L   80 (181)
                      |||++++++|++|+.+++++++|++|||+++..++.++|.+.++.+||||||||||..||+.|++++...+..|+.||+|
T Consensus        65 llR~~i~~~s~~g~~i~~~~~~G~lvpd~iv~~lv~~~l~~~~~~~g~ilDGfPRt~~Qa~~l~~~l~~~~~~~d~vi~l  144 (244)
T PLN02674         65 MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTVVQAQKLDEMLAKQGAKIDKVLNF  144 (244)
T ss_pred             HHHHHHhccChhhHHHHHHHHcCCccCHHHHHHHHHHHHhCcCcCCcEEEeCCCCCHHHHHHHHHHHHhcCCCCCEEEEE
Confidence            58999999999999999999999999999999999999998888899999999999999999999998889999999999


Q ss_pred             ecChHHHHHHHhCCCcCCCCCCccccCCCCCCCCCCCCCCCCCcccCCCCcHHHHHHHHHHHHHhcHHHHHHHhhcCCEE
Q 030234           81 AIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVA  160 (181)
Q Consensus        81 ~~~~~~~~~Rl~~r~~~~~tg~~y~~~~~pp~~~~~~~~~~~~l~~r~dd~~~~i~~Rl~~y~~~~~~l~~~y~~~~~l~  160 (181)
                      ++|++++++|+++|++||.||++||..++||+.++.|+.||++|++|.||+++.+++||+.|++++.||++||+++|+++
T Consensus       145 ~v~~~~l~~Rl~gR~~~~~~g~~yn~~~~pp~~~~~~~~~g~~L~~R~DD~~e~i~~RL~~Y~~~t~pv~~~Y~~~g~l~  224 (244)
T PLN02674        145 AIDDAILEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYAKKGVVA  224 (244)
T ss_pred             ECCHHHHHHHHhccccccccCCccccccCCCcccCcccccCCccccCCCCCHHHHHHHHHHHHHHhHHHHHHHHhcCCEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeCCCChHHHHHHHHHHhc
Q 030234          161 QLHAEKPPQEVTSEVQKALS  180 (181)
Q Consensus       161 ~Ida~~~~~~v~~~i~~~l~  180 (181)
                      .|||++++++||++|..+|+
T Consensus       225 ~Ida~~~~~eV~~~i~~~l~  244 (244)
T PLN02674        225 NLHAEKPPKEVTAEVQKALS  244 (244)
T ss_pred             EEECCCCHHHHHHHHHHHhC
Confidence            99999999999999998874

>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>KOG3078 consensus Adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>KOG3327 consensus Thymidylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01712 dNK: Deoxynucleoside kinase; InterPro: IPR002624 This family consists of various deoxynucleoside kinases including cytidine (2 Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PHA03132 thymidine kinase; Provisional Back     alignment and domain information
>KOG4235 consensus Mitochondrial thymidine kinase 2/deoxyguanosine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>TIGR03707 PPK2_P_aer polyphosphate kinase 2, PA0141 family Back     alignment and domain information
>COG1660 Predicted P-loop-containing kinase [General function prediction only] Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>TIGR03709 PPK2_rel_1 polyphosphate:nucleotide phosphotransferase, PPK2 family Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK12496 hypothetical protein; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
1aky_A220 High-Resolution Structures Of Adenylate Kinase From 5e-52
1ak2_A233 Adenylate Kinase Isoenzyme-2 Length = 233 5e-52
3aky_A220 Stability, Activity And Structure Of Adenylate Kina 1e-51
2c9y_A242 Structure Of Human Adenylate Kinase 2 Length = 242 2e-51
1dvr_A220 Structure Of A Mutant Adenylate Kinase Ligated With 8e-50
3be4_A217 Crystal Structure Of Cryptosporidium Parvum Adenyla 8e-48
3tlx_A243 Crystal Structure Of Pf10_0086, Adenylate Kinase Fr 2e-46
3fb4_A216 Crystal Structure Of Adenylate Kinase From Mariniba 5e-44
1zin_A217 Adenylate Kinase With Bound Ap5a Length = 217 2e-42
2osb_A216 Crystal Structure Of A Thermostable Mutant Of Bacil 2e-42
2eu8_A216 Crystal Structure Of A Thermostable Mutant Of Bacil 2e-42
2qaj_A217 Crystal Structure Of A Thermostable Mutant Of Bacil 3e-42
2p3s_A217 Crystal Structure Of A Thermostable Mutant Of Bacil 3e-42
1p3j_A217 Adenylate Kinase From Bacillus Subtilis Length = 21 3e-42
2ori_A216 Crystal Structure Of A Thermostable Mutant Of Bacil 7e-42
2oo7_A217 Crystal Structure Of A Thermostable Mutant Of Bacil 9e-42
2rgx_A206 Crystal Structure Of Adenylate Kinase From Aquifex 2e-41
3dl0_A216 Crystal Structure Of Adenylate Kinase Variant Aklse 2e-40
1e4y_A214 Mutant P9l Of Adenylate Kinase From E. Coli, Modifi 4e-40
1e4v_A214 Mutant G10v Of Adenylate Kinase From E. Coli, Modif 5e-40
1ake_A214 Structure Of The Complex Between Adenylate Kinase F 5e-40
3hpr_A214 Crystal Structure Of V148g Adenylate Kinase From E. 3e-39
3gmt_A230 Crystal Structure Of Adenylate Kinase From Burkhold 9e-39
3dkv_A217 Crystal Structure Of Adenylate Kinase Variant Aklse 2e-38
2ak3_A226 The Three-Dimensional Structure Of The Complex Betw 6e-36
1s3g_A217 Crystal Structure Of Adenylate Kinase From Bacillus 6e-36
1zd8_A227 Structure Of Human Adenylate Kinase 3 Like 1 Length 5e-35
2ar7_A246 Crystal Structure Of Human Adenylate Kinase 4, Ak4 8e-29
3ndp_A231 Crystal Structure Of Human Ak4(L171p) Length = 231 6e-28
1zak_A222 Adenylate Kinase From Maize In Complex With The Inh 1e-23
2cdn_A201 Crystal Structure Of Mycobacterium Tuberculosis Ade 3e-20
1p4s_A181 Solution Structure Of Mycobacterium Tuberculosis Ad 3e-20
3cm0_A186 Crystal Structure Of Adenylate Kinase From Thermus 1e-15
3l0p_A223 Crystal Structures Of Iron Containing Adenylate Kin 2e-15
2xb4_A223 Crystal Structures Of Zinc Containing Adenylate Kin 2e-15
1z83_A196 Crystal Structure Of Human Ak1a In Complex With Ap5 9e-14
3adk_A195 Refined Structure Of Porcine Cytosolic Adenylate Ki 9e-13
3umf_A217 Schistosoma Mansoni Adenylate Kinase Length = 217 3e-09
2bwj_A199 Structure Of Adenylate Kinase 5 Length = 199 2e-08
1tev_A196 Crystal Structure Of The Human UmpCMP KINASE IN OPE 5e-07
1uky_A203 Substrate Specificity And Assembly Of Catalytic Cen 2e-05
1qf9_A194 Ph Influences Fluoride Coordination Number Of The A 4e-04
>pdb|1AKY|A Chain A, High-Resolution Structures Of Adenylate Kinase From Yeast Ligated With Inhibitor Ap5a, Showing The Pathway Of Phosphoryl Transfer Length = 220 Back     alignment and structure 
Iteration: 1

 Score =  199 bits (507), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 128/181 (70%), Gaps = 1/181 (0%)
Query: 1   MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGII-DEAMKKPSCQKGFILDGFPRTEVQ 59
           MLR+ +A  T LG++AK+ MD+G LVSDD++V +I DE    P+C+ GFILDGFPRT  Q
Sbjct: 38  MLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQ 97
Query: 60  AQKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDV 119
           A+KLD+ML++QG  ++K +   +DD +L  RITGR IHP+SGR+YH  F PPK    DDV
Sbjct: 98  AEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDV 157
Query: 120 TGEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAEKPPQEVTSEVQKAL 179
           TGE L+QR DD A  LK RL A+H QTEP++D+Y K GI A + A +PP  V +++   L
Sbjct: 158 TGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKL 217
Query: 180 S 180
Sbjct: 218 G 218
>pdb|1AK2|A Chain A, Adenylate Kinase Isoenzyme-2 Length = 233 Back     alignment and structure
>pdb|3AKY|A Chain A, Stability, Activity And Structure Of Adenylate Kinase Mutants Length = 220 Back     alignment and structure
>pdb|2C9Y|A Chain A, Structure Of Human Adenylate Kinase 2 Length = 242 Back     alignment and structure
>pdb|1DVR|A Chain A, Structure Of A Mutant Adenylate Kinase Ligated With An Atp- Analogue Showing Domain Closure Over Atp Length = 220 Back     alignment and structure
>pdb|3BE4|A Chain A, Crystal Structure Of Cryptosporidium Parvum Adenylate Kinase Cgd5_3360 Length = 217 Back     alignment and structure
>pdb|3TLX|A Chain A, Crystal Structure Of Pf10_0086, Adenylate Kinase From Plasmodium Falciparum Length = 243 Back     alignment and structure
>pdb|3FB4|A Chain A, Crystal Structure Of Adenylate Kinase From Marinibacillus Marinus Length = 216 Back     alignment and structure
>pdb|1ZIN|A Chain A, Adenylate Kinase With Bound Ap5a Length = 217 Back     alignment and structure
>pdb|2OSB|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (q16l/q199r/) Length = 216 Back     alignment and structure
>pdb|2EU8|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (Q199r) Length = 216 Back     alignment and structure
>pdb|2QAJ|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (Q199rG213E) Length = 217 Back     alignment and structure
>pdb|2P3S|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (G214rQ199R) Length = 217 Back     alignment and structure
>pdb|1P3J|A Chain A, Adenylate Kinase From Bacillus Subtilis Length = 217 Back     alignment and structure
>pdb|2ORI|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (A193vQ199R) Length = 216 Back     alignment and structure
>pdb|2OO7|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (T179iQ199R) Length = 217 Back     alignment and structure
>pdb|2RGX|A Chain A, Crystal Structure Of Adenylate Kinase From Aquifex Aeolicus In Complex With Ap5a Length = 206 Back     alignment and structure
>pdb|3DL0|A Chain A, Crystal Structure Of Adenylate Kinase Variant Aklse3 Length = 216 Back     alignment and structure
>pdb|1E4Y|A Chain A, Mutant P9l Of Adenylate Kinase From E. Coli, Modified In The Gly-Loop Length = 214 Back     alignment and structure
>pdb|1E4V|A Chain A, Mutant G10v Of Adenylate Kinase From E. Coli, Modified In The Gly-Loop Length = 214 Back     alignment and structure
>pdb|1AKE|A Chain A, Structure Of The Complex Between Adenylate Kinase From Escherichia Coli And The Inhibitor Ap5a Refined At 1.9 Angstroms Resolution: A Model For A Catalytic Transition State Length = 214 Back     alignment and structure
>pdb|3HPR|A Chain A, Crystal Structure Of V148g Adenylate Kinase From E. Coli, In Complex With Ap5a Length = 214 Back     alignment and structure
>pdb|3GMT|A Chain A, Crystal Structure Of Adenylate Kinase From Burkholderia Pseu Length = 230 Back     alignment and structure
>pdb|3DKV|A Chain A, Crystal Structure Of Adenylate Kinase Variant Aklse1 Length = 217 Back     alignment and structure
>pdb|2AK3|A Chain A, The Three-Dimensional Structure Of The Complex Between Mitochondrial Matrix Adenylate Kinase And Its Substrate Amp At 1.85 Angstroms Resolution Length = 226 Back     alignment and structure
>pdb|1S3G|A Chain A, Crystal Structure Of Adenylate Kinase From Bacillus Globisporus Length = 217 Back     alignment and structure
>pdb|1ZD8|A Chain A, Structure Of Human Adenylate Kinase 3 Like 1 Length = 227 Back     alignment and structure
>pdb|2AR7|A Chain A, Crystal Structure Of Human Adenylate Kinase 4, Ak4 Length = 246 Back     alignment and structure
>pdb|3NDP|A Chain A, Crystal Structure Of Human Ak4(L171p) Length = 231 Back     alignment and structure
>pdb|1ZAK|A Chain A, Adenylate Kinase From Maize In Complex With The Inhibitor P1,P5-Bis(Adenosine-5'-)pentaphosphate (Ap5a) Length = 222 Back     alignment and structure
>pdb|2CDN|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Adenylate Kinase Complexed With Two Molecules Of Adp And Mg Length = 201 Back     alignment and structure
>pdb|1P4S|A Chain A, Solution Structure Of Mycobacterium Tuberculosis Adenylate Kinase Length = 181 Back     alignment and structure
>pdb|3CM0|A Chain A, Crystal Structure Of Adenylate Kinase From Thermus Thermophilus Hb8 Length = 186 Back     alignment and structure
>pdb|3L0P|A Chain A, Crystal Structures Of Iron Containing Adenylate Kinase From Desulfovibrio Gigas Length = 223 Back     alignment and structure
>pdb|2XB4|A Chain A, Crystal Structures Of Zinc Containing Adenylate Kinase From Desulfovibrio Gigas Length = 223 Back     alignment and structure
>pdb|1Z83|A Chain A, Crystal Structure Of Human Ak1a In Complex With Ap5a Length = 196 Back     alignment and structure
>pdb|3ADK|A Chain A, Refined Structure Of Porcine Cytosolic Adenylate Kinase At 2.1 Angstroms Resolution Length = 195 Back     alignment and structure
>pdb|3UMF|A Chain A, Schistosoma Mansoni Adenylate Kinase Length = 217 Back     alignment and structure
>pdb|2BWJ|A Chain A, Structure Of Adenylate Kinase 5 Length = 199 Back     alignment and structure
>pdb|1TEV|A Chain A, Crystal Structure Of The Human UmpCMP KINASE IN OPEN Conformation Length = 196 Back     alignment and structure
>pdb|1UKY|A Chain A, Substrate Specificity And Assembly Of Catalytic Center Derived From Two Structures Of Ligated Uridylate Kinase Length = 203 Back     alignment and structure
>pdb|1QF9|A Chain A, Ph Influences Fluoride Coordination Number Of The Alfx Phosphoryl Transfer Transition State Analog In UmpCMP Kinase Length = 194 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
3tlx_A243 Adenylate kinase 2; structural genomics, structura 1e-104
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 1e-103
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 1e-103
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 1e-102
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 1e-102
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 1e-102
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 7e-98
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 3e-96
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 1e-94
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 4e-93
2rgx_A206 Adenylate kinase; transferase(phosphotransferase), 2e-88
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 1e-87
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 6e-87
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 1e-63
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 2e-61
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 3e-58
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 1e-56
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 3e-55
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 1e-52
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 2e-51
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 7e-15
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Length = 243 Back     alignment and structure
 Score =  297 bits (762), Expect = e-104
 Identities = 84/181 (46%), Positives = 117/181 (64%)

Query: 1   MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQA 60
           +LR A   KT LG+K K  +++G+LV D +V+ ++DE +K P C+KGFILDG+PR   QA
Sbjct: 63  LLREAAEKKTELGLKIKNIINEGKLVDDQMVLSLVDEKLKTPQCKKGFILDGYPRNVKQA 122

Query: 61  QKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVT 120
           + L+++L+K   K+D V  F + D VL  RI+GR IH  SGR YH  F PPKVP  DDVT
Sbjct: 123 EDLNKLLQKNQTKLDGVFYFNVPDEVLVNRISGRLIHKPSGRIYHKIFNPPKVPFRDDVT 182

Query: 121 GEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAEKPPQEVTSEVQKALS 180
            EPLIQR+DD   VLK RL  F  +T P+I YY  K ++  L A +P  ++  ++ + + 
Sbjct: 183 NEPLIQREDDNEDVLKKRLTVFKSETSPLISYYKNKNLLINLDATQPANDLEKKISQHID 242

Query: 181 A 181
            
Sbjct: 243 G 243
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Length = 217 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Length = 233 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Length = 216 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, cytoplasm, metal-binding, nucleotide biosynthesis, nucleotide-binding; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Length = 216 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Length = 220 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Length = 214 Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 230 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Length = 246 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Length = 227 Back     alignment and structure
>2rgx_A Adenylate kinase; transferase(phosphotransferase), ATP-binding, nucleo binding, transferase; HET: AP5; 1.90A {Aquifex aeolicus} PDB: 2rh5_A Length = 206 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Length = 222 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Length = 223 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Length = 201 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Length = 186 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Length = 196 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Length = 199 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Length = 194 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Length = 196 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Length = 203 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Length = 189 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 100.0
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 100.0
3tlx_A243 Adenylate kinase 2; structural genomics, structura 100.0
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 100.0
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 100.0
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 100.0
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 100.0
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 100.0
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 100.0
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 100.0
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 100.0
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 99.97
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 99.95
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 99.87
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 99.87
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 99.84
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 99.81
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 99.81
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 99.8
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 99.79
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 99.79
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 99.3
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 99.03
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 99.02
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 98.91
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 98.82
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 98.77
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 98.68
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 98.67
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 98.66
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 98.66
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 98.63
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 98.55
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 98.52
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 98.49
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 98.32
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 98.32
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 98.26
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 98.24
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 98.22
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 98.21
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 98.21
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 98.1
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 98.02
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 98.01
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.97
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.95
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.9
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 97.82
2vli_A183 Antibiotic resistance protein; transferase, tunica 97.66
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.62
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.62
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.55
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 97.52
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 97.49
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.45
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.34
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 97.27
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 97.17
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 96.96
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.93
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.71
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 96.69
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.65
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.6
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.54
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.52
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.47
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.44
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.43
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.39
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.3
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.26
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.15
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.83
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.77
3czq_A304 Putative polyphosphate kinase 2; structural genomi 95.66
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 95.61
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.55
1via_A175 Shikimate kinase; structural genomics, transferase 95.43
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 95.3
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 94.73
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 94.32
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.9
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 93.69
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 93.09
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 92.87
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 92.76
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 92.2
3czp_A 500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 92.19
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 90.88
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 90.52
3czp_A500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 89.75
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 88.58
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 85.33
1kjw_A295 Postsynaptic density protein 95; protein-protein i 85.15
1p6x_A334 Thymidine kinase; P-loop, LID, transferase; HET: T 84.7
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 84.54
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 83.29
3rhf_A289 Putative polyphosphate kinase 2 family protein; PS 80.84
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
Probab=100.00  E-value=1.4e-50  Score=316.47  Aligned_cols=177  Identities=45%  Similarity=0.807  Sum_probs=153.3

Q ss_pred             ChhHHHhcCChHHHHHHHHHHCCCCCCHHHHHHHHHHHHcCCCCCCCeEecCCCCCHHHHHHHHHHHHhcCCCccEEEEe
Q 030234            1 MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEKQGKKVDKVLNF   80 (181)
Q Consensus         1 llr~~i~~~t~lg~~i~~~l~~G~~vpd~~v~~ll~~~l~~~~~~~G~iLdGfPrt~~Qa~~l~~~l~~~~~~p~~vi~L   80 (181)
                      +||++++.+|++|+.+++++.+|++|||++++++|+++|.+.+|.+||||||||||..||+.|+    +.+..|+.||+|
T Consensus        42 llR~~~~~~t~lG~~i~~~~~~G~lvpdei~~~ll~~~l~~~~~~~g~ILDGfPRt~~Qa~~L~----~~~~~~d~VI~L  117 (230)
T 3gmt_A           42 MLRAAVKAGTPLGVEAKTYMDEGKLVPDSLIIGLVKERLKEADCANGYLFDGFPRTIAQADAMK----EAGVAIDYVLEI  117 (230)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHTTTCCCCHHHHHHHHHHHHHSGGGTTCEEEESCCCSHHHHHHHH----HTTCCCSEEEEE
T ss_pred             HHHHhccCCChHHHHHHHHHhhccccccHHHHHHHHHHHhCcccCCCeEecCCCCcHHHHHHHH----HhCCCccEEEEE
Confidence            5799999999999999999999999999999999999999888889999999999999999875    356789999999


Q ss_pred             ecChHHHHHHHhCCCcCCCCCCccccCCCCCCCCCCCCCCCCCcccCCCCcHHHHHHHHHHHHHhcHHHHHHHhhc----
Q 030234           81 AIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKK----  156 (181)
Q Consensus        81 ~~~~~~~~~Rl~~r~~~~~tg~~y~~~~~pp~~~~~~~~~~~~l~~r~dd~~~~i~~Rl~~y~~~~~~l~~~y~~~----  156 (181)
                      +||++++++|+++|++||.||++||..|+||+.+++||.||++|++|+||+++.|++||+.|++++.||++||.+.    
T Consensus       118 dvp~e~l~~Rl~~R~~~~~~G~~Yh~~~~pp~~~~~~d~~g~~L~~R~DD~~e~i~~Rl~~y~~~t~pl~~~Y~~~~~~~  197 (230)
T 3gmt_A          118 DVPFSEIIERMSGRRTHPASGRTYHVKFNPPKVEGKDDVTGEPLVQRDDDKEETVKKRLDVYEAQTKPLITYYGDWARRG  197 (230)
T ss_dssp             CCCHHHHHHHHHTEEEETTTTEEEETTTBCCSSTTBCTTTCCBCBCCGGGSHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             eCCHHHHHHHHHcCCcccccCCcccccCCCCCccCcCCCccCccccCCCCCHHHHHHHHHHHHHHHHHHHHHHHhhhccc
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999973    


Q ss_pred             -------CCEEEEeCCCChHHHHHHHHHHhcC
Q 030234          157 -------GIVAQLHAEKPPQEVTSEVQKALSA  181 (181)
Q Consensus       157 -------~~l~~Ida~~~~~~v~~~i~~~l~~  181 (181)
                             ++++.|||++++++||++|.++|.+
T Consensus       198 ~~~~~~~~~l~~idg~~~~~eV~~~i~~~l~~  229 (230)
T 3gmt_A          198 AENGLKAPAYRKISGLGAVEEIRARVRRAQVS  229 (230)
T ss_dssp             CBTTBCCCEEEEECC-----------------
T ss_pred             ccccccCCeEEEEECCCCHHHHHHHHHHHHhc
Confidence                   7899999999999999999998753
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>3rhf_A Putative polyphosphate kinase 2 family protein; PSI-biology, MCSG, structural genomics, midwest center for S genomics; HET: PGE FLC PG4; 2.45A {Arthrobacter aurescens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 181
d2cdna1181 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium 1e-21
d1zina1182 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac 3e-20
d1s3ga1182 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac 3e-20
d1s3ga235 g.41.2.1 (A:126-160) Microbial and mitochondrial A 9e-20
d1akya238 g.41.2.1 (A:131-168) Microbial and mitochondrial A 2e-19
d1zina235 g.41.2.1 (A:126-160) Microbial and mitochondrial A 6e-19
d1ak2a1190 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Co 8e-19
d2ak3a237 g.41.2.1 (A:125-161) Microbial and mitochondrial A 5e-18
d1e4va235 g.41.2.1 (A:122-156) Microbial and mitochondrial A 5e-18
d1ak2a230 g.41.2.1 (A:147-176) Microbial and mitochondrial A 3e-16
d1e4va1179 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Esc 3e-15
d1akya1180 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Bak 3e-15
d3adka_194 c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [ 1e-14
d1teva_194 c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) 2e-13
d1ukza_196 c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Sac 2e-13
d1qf9a_194 c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi 1e-12
d1zaka1189 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai 2e-10
d2ak3a1189 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow 1e-09
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score = 84.6 bits (208), Expect = 1e-21
 Identities = 55/180 (30%), Positives = 87/180 (48%), Gaps = 33/180 (18%)

Query: 1   MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQA 60
           + R  +   T LG++AK  +D G+LV  DL   ++D+ +  P    GFILDG+PR+  QA
Sbjct: 34  LFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQA 93

Query: 61  QKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVT 120
           + L EMLE++G  +D VL F + + VL ER+ GR                          
Sbjct: 94  KALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRG------------------------- 128

Query: 121 GEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAEKPPQEVTSEVQKALS 180
                 R DDT  V+ +R++ +  +T P+++YY  +     + A     EV +   +AL 
Sbjct: 129 ------RADDTDDVILNRMKVYRDETAPLLEYYRDQLKT--VDAVGTMDEVFARALRALG 180
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Length = 182 Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Length = 182 Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Length = 35 Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 38 Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 35 Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Length = 190 Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Length = 37 Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Length = 35 Back     information, alignment and structure
>d1ak2a2 g.41.2.1 (A:147-176) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Length = 30 Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 180 Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 194 Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 194 Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Length = 189 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 99.97
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 99.96
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 99.96
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 99.96
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 99.95
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 99.95
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 99.95
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 99.94
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 99.94
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 99.93
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 99.93
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 99.89
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 99.43
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 99.32
d1e4va235 Microbial and mitochondrial ADK, insert "zinc fing 99.26
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 99.2
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 99.17
d1ak2a230 Microbial and mitochondrial ADK, insert "zinc fing 99.11
d1zaka231 Microbial and mitochondrial ADK, insert "zinc fing 98.85
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 98.68
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 98.32
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.24
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.21
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 98.06
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 98.01
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.75
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.7
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 97.61
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 97.57
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.49
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.37
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 96.57
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.77
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.68
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.61
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.38
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.35
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.01
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.79
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.42
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.34
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.13
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 91.92
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.34
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.48
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 88.61
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 88.02
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 87.0
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 84.17
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 83.07
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 82.52
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]

Probab=99.97  E-value=3.6e-29  Score=187.80  Aligned_cols=150  Identities=48%  Similarity=0.834  Sum_probs=140.5

Q ss_pred             ChhHHHhcCChHHHHHHHHHHCCCCCCHHHHHHHHHHHHcCCCCCCCeEecCCCCCHHHHHHHHHHHHhcCCCccEEEEe
Q 030234            1 MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEKQGKKVDKVLNF   80 (181)
Q Consensus         1 llr~~i~~~t~lg~~i~~~l~~G~~vpd~~v~~ll~~~l~~~~~~~G~iLdGfPrt~~Qa~~l~~~l~~~~~~p~~vi~L   80 (181)
                      |||++...+|+.|..+..++++|..+|++.+..++..++....+.+|||||||||+..||..|...+...+..+.+++.|
T Consensus        37 llr~~~~~~~~~g~~~~~~~~~g~~~~~~~v~~~~~~~l~~~~~~~g~ii~g~pr~~~qa~~l~~~~~~~~~~~~~~~~l  116 (190)
T d1ak2a1          37 MLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEF  116 (190)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHTTCCCCHHHHHHHHHHHHTSGGGTTCEEEESCCCSHHHHHHHHHHHHHHTCCCCEEEEE
T ss_pred             HHHHHHhccCcccchhhhhhccCCccccceeeeeehhhhccccccCceeecccccchhHHHHHHHHhhhccccccccccc
Confidence            57999999999999999999999999999999999999988777799999999999999999988887788899999999


Q ss_pred             ecChHHHHHHHhCCCcCCCCCCccccCCCCCCCCCCCCCCCCCcccCCCCcHHHHHHHHHHHHHhcHHHHHHHhhcCCEE
Q 030234           81 AIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVA  160 (181)
Q Consensus        81 ~~~~~~~~~Rl~~r~~~~~tg~~y~~~~~pp~~~~~~~~~~~~l~~r~dd~~~~i~~Rl~~y~~~~~~l~~~y~~~~~l~  160 (181)
                      +|+++.+.+|+..|..                              +.|++++.+++|++.|++.+.|+.+||.+.+.++
T Consensus       117 ~v~~~~~~~r~~~r~~------------------------------~~d~~~e~i~~R~~~y~~~~~p~~~~y~~~~~~~  166 (190)
T d1ak2a1         117 SIPDSLLIRRITGRLI------------------------------HSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHS  166 (190)
T ss_dssp             ECCHHHHHHHHHTCEE------------------------------CCCCCHHHHHHHHHHHHHHHHHHHHHHHHTTCEE
T ss_pred             cchHHHHHhhhccCCC------------------------------CCchhhHHHHHHHHHHHHHHHHHHHHHHhcCCEE
Confidence            9999999999999863                              4577899999999999999999999999989999


Q ss_pred             EEeCCCChHHHHHHHHHHhc
Q 030234          161 QLHAEKPPQEVTSEVQKALS  180 (181)
Q Consensus       161 ~Ida~~~~~~v~~~i~~~l~  180 (181)
                      .|||++++++||++|+++|+
T Consensus       167 ~Id~~~s~eeV~~~I~~~l~  186 (190)
T d1ak2a1         167 AIDASQTPDVVFASILAAFS  186 (190)
T ss_dssp             EEETTSCHHHHHHHHHHHHH
T ss_pred             EEECCCCHHHHHHHHHHHHH
Confidence            99999999999999999875
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ak2a2 g.41.2.1 (A:147-176) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zaka2 g.41.2.1 (A:128-158) Microbial and mitochondrial ADK, insert "zinc finger" domain {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure