Citrus Sinensis ID: 030248

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
MGWIGESIESIKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFLHMSKDPIRAGEIVVFNVDGREIPIVHRVIKVHERQDTGEVEVLTKGDNNYGDDRLLYAQGQLWLKRQHIMGRAVGFLPYVGWVTIIMTEKPIIKYILIGALGLLVITSKD
cccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccccEEEEECcccccccccEEEEEEccccCEEEEEEEEEEECccccCEEEEECccccccccccccccccEEEEEEEEEEEEEEEccccEEEEEEEccccHHHHHHHHHHHHHEEEccc
***IGESIESIKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFLHMSKDPIRAGEIVVFNVDGREIPIVHRVIKVHERQDTGEVEVLTKGDNNYGDDRLLYAQGQLWLKRQHIMGRAVGFLPYVGWVTIIMTEKPIIKYILIGALGLLVITSKD
xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGWIGESIESIKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFLHMSKDPIRAGEIVVFNVDGREIPIVHRVIKVHERQDTGEVEVLTKGDNNYGDDRLLYAQGQLWLKRQHIMGRAVGFLPYVGWVTIIMTEKPIIKYILIGALGLLVITSKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal peptidase complex catalytic subunit SEC11C Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.probableQ9BY50
Signal peptidase complex catalytic subunit sec11 Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.probableQ86JD4
Signal peptidase complex catalytic subunit SEC11C Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.probableQ9WTR7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JHF, chain A
Confidence level:confident
Coverage over the Query: 50-149
View the alignment between query and template
View the model in PyMOL