Citrus Sinensis ID: 030254

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180

MGWIGESIESVKSMKIRDSLFQFITLGMIVSSALIIWKGLMCITGSESPVVVVLSESMEPGFQRGDILFLQMSKDPIRTGEIVVFNIQGRDIPIVHRVIEVHEQRQSGEVRILTKGDNNDVDDRMLYAQGQFWLKQEHIMGRAVGFLPYVGWATIIMTEKPIIKYILIGALGLLVITSKD

ccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccccEEEEECcccccccccEEEEEEccccccEEEEEEEEEEECcccCEEEEECcccccccccHHHcccccccEEEEEEEEEEEEccccEEEEEEEccccHHHHHHHHHHHHHEEEccc

*******IESVKSMKIRDSLFQFITLGMIVSSALIIWKGLMCITGSESPVVVVLSESMEPGFQRGDILFLQMSKDPIRTGEIVVFNIQGRDIPIVHRVIEVHEQRQSGEVRILTKGDNNDVDDRMLYAQGQFWLKQEHIMGRAVGFLPYVGWATIIMTEKPIIKYILIGALGLLVITSKD

xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGWIGESIESVKSMKIRDSLFQFITLGMIVSSALIIWKGLMCITGSESPVVVVLSESMEPGFQRGDILFLQMSKDPIRTGEIVVFNIQGRDIPIVHRVIEVHEQRQSGEVRILTKGDNNDVDDRMLYAQGQFWLKQEHIMGRAVGFLPYVGWATIIMTEKPIIKYILIGALGLLVITSKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Signal peptidase complex catalytic subunit SEC11C	Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.	probable	Q9BY50
Signal peptidase complex catalytic subunit sec11	Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.	probable	Q86JD4
Signal peptidase complex catalytic subunit SEC11C	Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.	probable	Q9WTR7

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JHF, chain A
Confidence level:confident
Coverage over the Query: 50-149
View the alignment between query and template
View the model in PyMOL