Citrus Sinensis ID: 030281

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
MWYSSGSFDGKNDDQNMDEVDDVFDDFVVEKQELQPQGVDPRRGWGFRGVHKAIICGKVKDTPVQKILRNGKTVTIFSVGTGGLFDQRIVGSKDLPKPVQWHRIAVHNEILGSYAVKQLVKNSSVYVEGDIEIRVYNDSINGEVKNIPEICIRRDGTLRLVKSGESISKISFDDLREGLL
cccccccccccccccccccccccccccHHccccccccccccccccccccccEEEEEccccccccEEEcccccEEEEEEccccccccccccccccccccccEEEEEEEcccHHHHHHHHcccccEEEEEcEEccEEEccccccEEEEEcEEEEEEccEEEEEEcccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccEEEcEEEEEEEEcccccccEEEcccccEEEEEEEEccccccccccccccccccccEEEEEEEcHHHHHHHHHHHccccEEEEEEEEEEEEEEccccccEEEEEEEEEEcccEEEEEccccccccccHHHHHcccc
mwyssgsfdgknddqnmdevdDVFDDFVVEKqelqpqgvdprrgwgfrgvHKAIIcgkvkdtpvqkilrngkTVTIFSVgtgglfdqrivgskdlpkpvqwHRIAVHNEILGSYAVKQLVKnssvyvegDIEIRVYndsingevknipeicirrdgtlrlvksgesiskisFDDLREGLL
mwyssgsfdgknddqnmDEVDDVFDDFVVEKQelqpqgvdprrgwgFRGVHKAiicgkvkdtpvqkilrngktvtifsvgtgglfdqrivgSKDLPKPVQWHRIAVHNEILGSYAVKQLVKNSSVYVEGDIEirvyndsingevknipeicirrdgtlrlvksgesiskisfddlregll
MWYSSGSFDGknddqnmdevddvfddfvvekqELQPQGVDPRRGWGFRGVHKAIICGKVKDTPVQKILRNGKTVTIFSVGTGGLFDQRIVGSKDLPKPVQWHRIAVHNEILGSYAVKQLVKNSSVYVEGDIEIRVYNDSINGEVKNIPEICIRRDGTLRLVKSGESISKISFDDLREGLL
**********************VFDDFVVEK******GVDPRRGWGFRGVHKAIICGKVKDTPVQKILRNGKTVTIFSVGTGGLFDQRIVGSKDLPKPVQWHRIAVHNEILGSYAVKQLVKNSSVYVEGDIEIRVYNDSINGEVKNIPEICIRRDGTLRLVK******************
*********************************************GFRGVHKAIICGKVKDTPVQKILRNGKTVTIFSVGTGGLFDQ********PKPVQWHRIAVHNEILGSYAVKQLVKNSSVYVEGDIEIRVYNDSINGEVKNIPEICIRRDGT***********************
*********GKNDDQNMDEVDDVFDDFVVEKQELQPQGVDPRRGWGFRGVHKAIICGKVKDTPVQKILRNGKTVTIFSVGTGGLFDQRIVGSKDLPKPVQWHRIAVHNEILGSYAVKQLVKNSSVYVEGDIEIRVYNDSINGEVKNIPEICIRRDGTLRLVKSGESISKISFDDLREGLL
****************************VEKQELQPQGVDPRRGWGFRGVHKAIICGKVKDTPVQKILRNGKTVTIFSVGTGGLFDQR*****DLPKPVQWHRIAVHNEILGSYAVKQLVKNSSVYVEGDIEIRVYNDSINGEVKNIPEICIRRDGTLRLVKS*****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWYSSGSFDGKNDDQNMDEVDDVFDDFVVEKQELQPQGVDPRRGWGFRGVHKAIICGKVKDTPVQKILRNGKTVTIFSVGTGGLFDQRIVGSKDLPKPVQWHRIAVHNEILGSYAVKQLVKNSSVYVEGDIEIRVYNDSINGEVKNIPEICIRRDGTLRLVKSGESISKISFDDLREGLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query180 2.2.26 [Sep-21-2011]
Q84J78201 Single-stranded DNA-bindi yes no 0.95 0.850 0.687 1e-71
Q89A53166 Single-stranded DNA-bindi yes no 0.633 0.686 0.322 5e-09
P28045175 Plasmid-derived single-st yes no 0.605 0.622 0.283 6e-08
P18022175 Plasmid-derived single-st yes no 0.6 0.617 0.285 6e-08
Q8D254163 Single-stranded DNA-bindi yes no 0.611 0.674 0.280 3e-07
P18310179 Plasmid-derived single-st N/A no 0.605 0.608 0.271 5e-07
P28043179 Plasmid-derived single-st yes no 0.605 0.608 0.271 5e-07
P28044175 Plasmid-derived single-st yes no 0.605 0.622 0.271 5e-07
Q9RHF4178 Single-stranded DNA-bindi N/A no 0.611 0.617 0.280 6e-07
Q9ZAQ8173 Single-stranded DNA-bindi yes no 0.561 0.583 0.298 1e-06
>sp|Q84J78|SSBP_ARATH Single-stranded DNA-binding protein, mitochondrial OS=Arabidopsis thaliana GN=At4g11060 PE=2 SV=1 Back     alignment and function desciption
 Score =  268 bits (685), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 123/179 (68%), Positives = 152/179 (84%), Gaps = 8/179 (4%)

Query: 2   WYSSGSFDGKNDDQNMDEVDDVFDDFVVEKQELQPQGVDPRRGWGFRGVHKAIICGKVKD 61
           W+S+G  D        + V++ F++ V E+ ELQP GVDPR+GWGFRGVH+AIICGKV  
Sbjct: 31  WFSTGPID--------EGVEEDFEENVTERPELQPHGVDPRKGWGFRGVHRAIICGKVGQ 82

Query: 62  TPVQKILRNGKTVTIFSVGTGGLFDQRIVGSKDLPKPVQWHRIAVHNEILGSYAVKQLVK 121
            P+QKILRNG+TVTIF+VGTGG+FDQR+VG+ + PKP QWHRIAVHNE+LGSYAV++L K
Sbjct: 83  APLQKILRNGRTVTIFTVGTGGMFDQRLVGATNQPKPAQWHRIAVHNEVLGSYAVQKLAK 142

Query: 122 NSSVYVEGDIEIRVYNDSINGEVKNIPEICIRRDGTLRLVKSGESISKISFDDLREGLL 180
           NSSVYVEGDIE RVYNDSI+ EVK+IPEIC+RRDG +R++K GESISKISFD+L+EGL+
Sbjct: 143 NSSVYVEGDIETRVYNDSISSEVKSIPEICVRRDGKIRMIKYGESISKISFDELKEGLI 201
Binds to ss-DNA.
Arabidopsis thaliana (taxid: 3702)
>sp|Q89A53|SSB_BUCBP Single-stranded DNA-binding protein OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ssb PE=3 SV=1 Back     alignment and function description
>sp|P28045|SSBR_ECOLX Plasmid-derived single-stranded DNA-binding protein OS=Escherichia coli GN=ssb PE=3 SV=2 Back     alignment and function description
>sp|P18022|SSBP_ECOLX Plasmid-derived single-stranded DNA-binding protein OS=Escherichia coli GN=ssb PE=3 SV=3 Back     alignment and function description
>sp|Q8D254|SSB_WIGBR Single-stranded DNA-binding protein OS=Wigglesworthia glossinidia brevipalpis GN=ssb PE=3 SV=2 Back     alignment and function description
>sp|P18310|SSBF_ECOLI Plasmid-derived single-stranded DNA-binding protein OS=Escherichia coli (strain K12) GN=ssbF PE=1 SV=3 Back     alignment and function description
>sp|P28043|SSB2_ECOLX Plasmid-derived single-stranded DNA-binding protein OS=Escherichia coli GN=ssb PE=3 SV=2 Back     alignment and function description
>sp|P28044|SSB7_ECOLX Plasmid-derived single-stranded DNA-binding protein OS=Escherichia coli GN=ssb PE=3 SV=2 Back     alignment and function description
>sp|Q9RHF4|SSB2_SALTI Single-stranded DNA-binding protein 2 OS=Salmonella typhi GN=ssb2 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZAQ8|SSB_RHOS4 Single-stranded DNA-binding protein OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ssb PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
255576768213 Single-stranded DNA-binding protein, mit 0.988 0.835 0.775 4e-77
224125080215 predicted protein [Populus trichocarpa] 0.988 0.827 0.724 1e-72
357441825212 Single-stranded DNA-binding protein [Med 0.938 0.797 0.763 3e-72
449435603214 PREDICTED: single-stranded DNA-binding p 0.983 0.827 0.7 5e-71
449485644214 PREDICTED: single-stranded DNA-binding p 0.983 0.827 0.7 6e-71
356535041217 PREDICTED: single-stranded DNA-binding p 0.994 0.824 0.704 6e-71
225450667208 PREDICTED: single-stranded DNA-binding p 0.988 0.855 0.754 1e-70
388505152220 unknown [Lotus japonicus] 0.994 0.813 0.698 4e-70
30681642201 Single-stranded DNA-binding protein [Ara 0.95 0.850 0.687 7e-70
124359154216 Single-stranded DNA binding [Medicago tr 0.911 0.759 0.762 9e-70
>gi|255576768|ref|XP_002529271.1| Single-stranded DNA-binding protein, mitochondrial precursor, putative [Ricinus communis] gi|223531260|gb|EEF33103.1| Single-stranded DNA-binding protein, mitochondrial precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  292 bits (747), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 138/178 (77%), Positives = 157/178 (88%)

Query: 3   YSSGSFDGKNDDQNMDEVDDVFDDFVVEKQELQPQGVDPRRGWGFRGVHKAIICGKVKDT 62
           YS+ SF G+ND    +E+D+ FDDF+ EK ELQ QGVDPR+GWGFRGVHKAIICGKV   
Sbjct: 36  YSTESFSGENDVGKNNELDEEFDDFLGEKPELQIQGVDPRKGWGFRGVHKAIICGKVGQA 95

Query: 63  PVQKILRNGKTVTIFSVGTGGLFDQRIVGSKDLPKPVQWHRIAVHNEILGSYAVKQLVKN 122
           PVQKILRNG+TVTIF+VGTGG+FDQRIVG+KDLPKP QWHRIAVHNE LG+YAV+QL KN
Sbjct: 96  PVQKILRNGRTVTIFTVGTGGMFDQRIVGAKDLPKPAQWHRIAVHNETLGAYAVQQLAKN 155

Query: 123 SSVYVEGDIEIRVYNDSINGEVKNIPEICIRRDGTLRLVKSGESISKISFDDLREGLL 180
           SSVYVEG+IE RVYNDSI+GEVKNIPEICIRRDG +RLV SG+++S ISFDDLREGL 
Sbjct: 156 SSVYVEGEIETRVYNDSISGEVKNIPEICIRRDGKIRLVTSGKNVSDISFDDLREGLF 213

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224125080|ref|XP_002319495.1| predicted protein [Populus trichocarpa] gi|222857871|gb|EEE95418.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357441825|ref|XP_003591190.1| Single-stranded DNA-binding protein [Medicago truncatula] gi|355480238|gb|AES61441.1| Single-stranded DNA-binding protein [Medicago truncatula] gi|388493454|gb|AFK34793.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449435603|ref|XP_004135584.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449485644|ref|XP_004157233.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356535041|ref|XP_003536057.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|225450667|ref|XP_002278555.1| PREDICTED: single-stranded DNA-binding protein, mitochondrial [Vitis vinifera] gi|296089740|emb|CBI39559.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388505152|gb|AFK40642.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|30681642|ref|NP_192844.2| Single-stranded DNA-binding protein [Arabidopsis thaliana] gi|38258307|sp|Q84J78.1|SSB_ARATH RecName: Full=Single-stranded DNA-binding protein, mitochondrial; Flags: Precursor gi|28393531|gb|AAO42186.1| unknown protein [Arabidopsis thaliana] gi|28827408|gb|AAO50548.1| unknown protein [Arabidopsis thaliana] gi|34556071|emb|CAE46651.1| single-stranded DNA binding protein [Arabidopsis thaliana] gi|332657567|gb|AEE82967.1| Single-stranded DNA-binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|124359154|gb|ABD28355.2| Single-stranded DNA binding [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
TAIR|locus:2136083201 MTSSB "mitochondrially targete 0.822 0.736 0.777 1.1e-62
TAIR|locus:2086889217 AT3G18580 [Arabidopsis thalian 0.705 0.585 0.377 1.5e-19
UNIPROTKB|P0AGE0178 ssb "ssDNA-binding protein" [E 0.611 0.617 0.263 2.2e-09
TIGR_CMR|ECH_0815157 ECH_0815 "single-strand bindin 0.505 0.579 0.290 1.6e-08
TIGR_CMR|CBU_0271158 CBU_0271 "single-strand bindin 0.533 0.607 0.330 2e-08
GENEDB_PFALCIPARUM|PFE0435c284 PFE0435c "single-strand bindin 0.572 0.362 0.301 2.4e-08
UNIPROTKB|Q8I415284 PFE0435c "Single-strand bindin 0.572 0.362 0.301 2.4e-08
ZFIN|ZDB-GENE-050417-340146 ssbp1 "single-stranded DNA bin 0.522 0.643 0.309 3.3e-08
TIGR_CMR|SO_4028 238 SO_4028 "single-strand binding 0.594 0.449 0.3 3.9e-08
UNIPROTKB|Q9KUW2177 ssb "Single-stranded DNA-bindi 0.611 0.621 0.243 5.3e-08
TAIR|locus:2136083 MTSSB "mitochondrially targeted single-stranded DNA binding protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 640 (230.4 bits), Expect = 1.1e-62, P = 1.1e-62
 Identities = 115/148 (77%), Positives = 136/148 (91%)

Query:    33 ELQPQGVDPRRGWGFRGVHKAIICGKVKDTPVQKILRNGKTVTIFSVGTGGLFDQRIVGS 92
             ELQP GVDPR+GWGFRGVH+AIICGKV   P+QKILRNG+TVTIF+VGTGG+FDQR+VG+
Sbjct:    54 ELQPHGVDPRKGWGFRGVHRAIICGKVGQAPLQKILRNGRTVTIFTVGTGGMFDQRLVGA 113

Query:    93 KDLPKPVQWHRIAVHNEILGSYAVKQLVKNSSVYVEGDIEIRVYNDSINGEVKNIPEICI 152
              + PKP QWHRIAVHNE+LGSYAV++L KNSSVYVEGDIE RVYNDSI+ EVK+IPEIC+
Sbjct:   114 TNQPKPAQWHRIAVHNEVLGSYAVQKLAKNSSVYVEGDIETRVYNDSISSEVKSIPEICV 173

Query:   153 RRDGTLRLVKSGESISKISFDDLREGLL 180
             RRDG +R++K GESISKISFD+L+EGL+
Sbjct:   174 RRDGKIRMIKYGESISKISFDELKEGLI 201
GO:0003697 "single-stranded DNA binding" evidence=IEA;ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
TAIR|locus:2086889 AT3G18580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P0AGE0 ssb "ssDNA-binding protein" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0815 ECH_0815 "single-strand binding protein" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0271 CBU_0271 "single-strand binding protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFE0435c PFE0435c "single-strand binding protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8I415 PFE0435c "Single-strand binding protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-340 ssbp1 "single-stranded DNA binding protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4028 SO_4028 "single-strand binding protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KUW2 ssb "Single-stranded DNA-binding protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q84J78SSBP_ARATHNo assigned EC number0.68710.950.8507yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
pfam00436104 pfam00436, SSB, Single-strand binding protein fami 1e-17
cd04496100 cd04496, SSB_OBF, SSB_OBF: A subfamily of OB folds 1e-12
PRK13732175 PRK13732, PRK13732, single-stranded DNA-binding pr 6e-09
PRK06642152 PRK06642, PRK06642, single-stranded DNA-binding pr 2e-08
PRK05733172 PRK05733, PRK05733, single-stranded DNA-binding pr 1e-07
PRK06863168 PRK06863, PRK06863, single-stranded DNA-binding pr 2e-07
PRK09010177 PRK09010, PRK09010, single-stranded DNA-binding pr 3e-06
TIGR00621164 TIGR00621, ssb, single stranded DNA-binding protei 2e-05
PRK06958182 PRK06958, PRK06958, single-stranded DNA-binding pr 5e-05
PRK08763164 PRK08763, PRK08763, single-stranded DNA-binding pr 5e-05
PRK06341166 PRK06341, PRK06341, single-stranded DNA-binding pr 4e-04
>gnl|CDD|215919 pfam00436, SSB, Single-strand binding protein family Back     alignment and domain information 
 Score = 73.4 bits (181), Expect = 1e-17
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 5/105 (4%)

Query: 50  VHKAIICGKVKDTPVQKILRNGKTVTIFSVGTGGLFDQRIVGSKDLPKPVQWHRIAVHNE 109
           ++K I+ G++   P  +   NG  V  F++     F  +   + +  +   + R+ V  +
Sbjct: 1   MNKVILVGRLTRDPELRYTPNGNAVANFTLAVNRRFKDQ---NGEGDEETDFIRVVVWGK 57

Query: 110 ILGSYAVKQLVKNSSVYVEGDIEIRVYNDSINGEVKNIPEICIRR 154
            L   A + L K S VYVEG +  R Y D   G+ + + EI    
Sbjct: 58  -LAENAAEYLKKGSLVYVEGRLRTRKYEDQ-EGQKRYVTEIVADE 100

This family includes single stranded binding proteins and also the primosomal replication protein N (PriB). PriB forms a complex with PriA, PriC and ssDNA. Length = 104
>gnl|CDD|239942 cd04496, SSB_OBF, SSB_OBF: A subfamily of OB folds similar to the OB fold of ssDNA-binding protein (SSB) Back     alignment and domain information
>gnl|CDD|184284 PRK13732, PRK13732, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|135984 PRK06642, PRK06642, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|235585 PRK05733, PRK05733, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|136097 PRK06863, PRK06863, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236362 PRK09010, PRK09010, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233057 TIGR00621, ssb, single stranded DNA-binding protein (ssb) Back     alignment and domain information
>gnl|CDD|180777 PRK06958, PRK06958, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181549 PRK08763, PRK08763, single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|235782 PRK06341, PRK06341, single-stranded DNA-binding protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 180
PRK06752112 single-stranded DNA-binding protein; Validated 100.0
PRK07275162 single-stranded DNA-binding protein; Provisional 99.98
PRK09010177 single-stranded DNA-binding protein; Provisional 99.98
PRK06642152 single-stranded DNA-binding protein; Provisional 99.98
PRK06863168 single-stranded DNA-binding protein; Provisional 99.98
PRK06958182 single-stranded DNA-binding protein; Provisional 99.98
PRK13732175 single-stranded DNA-binding protein; Provisional 99.97
PRK08763164 single-stranded DNA-binding protein; Provisional 99.97
PRK07459121 single-stranded DNA-binding protein; Provisional 99.97
PRK08486182 single-stranded DNA-binding protein; Provisional 99.97
PRK05733172 single-stranded DNA-binding protein; Provisional 99.97
PRK07274131 single-stranded DNA-binding protein; Provisional 99.97
PRK06751173 single-stranded DNA-binding protein; Provisional 99.97
TIGR00621164 ssb single stranded DNA-binding protein (ssb). Thi 99.97
PRK06341166 single-stranded DNA-binding protein; Provisional 99.97
PRK08182148 single-stranded DNA-binding protein; Provisional 99.97
PRK06293161 single-stranded DNA-binding protein; Provisional 99.96
PF00436104 SSB: Single-strand binding protein family; InterPr 99.95
KOG1653175 consensus Single-stranded DNA-binding protein [Rep 99.95
PRK07772186 single-stranded DNA-binding protein; Provisional 99.95
COG0629167 Ssb Single-stranded DNA-binding protein [DNA repli 99.94
PRK05813219 single-stranded DNA-binding protein; Provisional 99.93
PRK05853161 hypothetical protein; Validated 99.92
PRK02801101 primosomal replication protein N; Provisional 99.92
cd04496100 SSB_OBF SSB_OBF: A subfamily of OB folds similar t 99.9
PRK05813219 single-stranded DNA-binding protein; Provisional 99.82
PRK00036107 primosomal replication protein N; Reviewed 98.51
COG2965103 PriB Primosomal replication protein N [DNA replica 98.4
PF0133675 tRNA_anti-codon: OB-fold nucleic acid binding doma 97.51
cd0448482 polC_OBF polC_OBF: A subfamily of OB folds corresp 96.37
cd0448773 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB f 96.33
cd04474104 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds cor 96.29
cd0449283 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB fol 96.21
cd0448978 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB fol 96.07
cd0448584 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresp 95.89
PRK13480 314 3'-5' exoribonuclease YhaM; Provisional 95.84
PRK15491374 replication factor A; Provisional 95.59
PRK07211 485 replication factor A; Reviewed 95.39
PRK15491 374 replication factor A; Provisional 95.38
cd0448291 RPA2_OBF_like RPA2_OBF_like: A subgroup of unchara 95.14
PRK07211 485 replication factor A; Reviewed 94.08
PF1132584 DUF3127: Domain of unknown function (DUF3127); Int 93.72
cd0448875 RecG_wedge_OBF RecG_wedge_OBF: A subfamily of OB f 93.18
cd0352475 RPA2_OBF_family RPA2_OBF_family: A family of oligo 92.83
PRK06461129 single-stranded DNA-binding protein; Reviewed 92.68
cd0449079 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds 91.7
PRK14699 484 replication factor A; Provisional 91.62
PRK00286 438 xseA exodeoxyribonuclease VII large subunit; Revie 91.37
cd0449182 SoSSB_OBF SoSSB_OBF: A subfamily of OB folds simil 91.31
PRK12366 637 replication factor A; Reviewed 90.93
PF1374299 tRNA_anti_2: OB-fold nucleic acid binding domain 90.59
COG3390196 Uncharacterized protein conserved in archaea [Func 90.34
TIGR00617 608 rpa1 replication factor-a protein 1 (rpa1). This f 89.71
TIGR00237 432 xseA exodeoxyribonuclease VII, large subunit. This 88.87
PRK12366 637 replication factor A; Reviewed 88.19
PRK07373449 DNA polymerase III subunit alpha; Reviewed 88.08
PRK08402 355 replication factor A; Reviewed 88.08
PRK14699484 replication factor A; Provisional 87.41
cd04475101 RPA1_DBD_B RPA1_DBD_B: A subfamily of OB folds cor 87.33
PF11506104 DUF3217: Protein of unknown function (DUF3217); In 86.26
PRK056731135 dnaE DNA polymerase III subunit alpha; Validated 86.11
PRK068261151 dnaE DNA polymerase III DnaE; Reviewed 83.62
TIGR01405 1213 polC_Gram_pos DNA polymerase III, alpha chain, Gra 83.35
PRK069201107 dnaE DNA polymerase III DnaE; Reviewed 82.97
PRK00448 1437 polC DNA polymerase III PolC; Validated 80.51
>PRK06752 single-stranded DNA-binding protein; Validated Back     alignment and domain information 
Probab=100.00  E-value=5.2e-32  Score=203.37  Aligned_cols=109  Identities=18%  Similarity=0.310  Sum_probs=102.2

Q ss_pred             cccEEEEEEEeCCCCeEEEecCCeEEEEEEEEECCceeccCCCcccCCCCceEEEEEecCchhHHHHHHhcCCCCeEEEE
Q 030281           49 GVHKAIICGKVKDTPVQKILRNGKTVTIFSVGTGGLFDQRIVGSKDLPKPVQWHRIAVHNEILGSYAVKQLVKNSSVYVE  128 (180)
Q Consensus        49 ~mN~v~L~Grlg~dPe~r~t~nG~~v~~fsVa~~~~~~d~~~Ge~~~~~~t~w~~V~~~gk~~Ae~~~~~l~KG~~V~Ve  128 (180)
                      |||+|+|+|||++||+++++++|+.+++|+||+++.|++.. |++    .++||+|++||+ +|+.++++|+||++|+|+
T Consensus         1 MmN~v~liGrl~~dPelr~t~~G~~~~~f~lAv~~~~~~~~-g~~----~t~~~~v~~wg~-~Ae~~~~~l~KG~~V~V~   74 (112)
T PRK06752          1 MMNRVVLIGRLTKEPELYYTKQGVAYARVCVAVNRGFRNSL-GEQ----QVDFINCVVWRK-SAENVTEYCTKGSLVGIT   74 (112)
T ss_pred             CceEEEEEEECcCCCEEEECCCCCEEEEEEEEECCCeEcCC-CCE----EEEEEEEEEehH-HHHHHHHhcCCCCEEEEE
Confidence            69999999999999999999999999999999999998763 653    689999999999 999999999999999999


Q ss_pred             EEeEEeeeecCCCCeEEEEEEEEEEeCCceEEecCCCCC
Q 030281          129 GDIEIRVYNDSINGEVKNIPEICIRRDGTLRLVKSGESI  167 (180)
Q Consensus       129 GrL~~~~y~d~~dG~~~~~~eI~v~~~g~i~~l~~k~~~  167 (180)
                      |+|+++.|+++ +|++++.++|+|+   +|.||+++...
T Consensus        75 G~l~~~~~~~~-~G~~~~~~ei~a~---~i~~l~~~~~~  109 (112)
T PRK06752         75 GRIHTRNYEDD-QGKRIYITEVVIE---SITFLERRREG  109 (112)
T ss_pred             EEEEeCccCCC-CCcEEEEEEEEEE---EEEECCCCCcc
Confidence            99999999998 9999999999999   99999988643

>PRK07275 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK09010 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06642 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06863 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06958 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK13732 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK08763 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK07459 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK08486 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK05733 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK07274 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06751 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>TIGR00621 ssb single stranded DNA-binding protein (ssb) Back     alignment and domain information
>PRK06341 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK08182 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK06293 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PF00436 SSB: Single-strand binding protein family; InterPro: IPR000424 The Escherichia coli single-strand binding protein [] (gene ssb), also known as the helix-destabilising protein, is a protein of 177 amino acids Back     alignment and domain information
>KOG1653 consensus Single-stranded DNA-binding protein [Replication, recombination and repair] Back     alignment and domain information
>PRK07772 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>COG0629 Ssb Single-stranded DNA-binding protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05813 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK05853 hypothetical protein; Validated Back     alignment and domain information
>PRK02801 primosomal replication protein N; Provisional Back     alignment and domain information
>cd04496 SSB_OBF SSB_OBF: A subfamily of OB folds similar to the OB fold of ssDNA-binding protein (SSB) Back     alignment and domain information
>PRK05813 single-stranded DNA-binding protein; Provisional Back     alignment and domain information
>PRK00036 primosomal replication protein N; Reviewed Back     alignment and domain information
>COG2965 PriB Primosomal replication protein N [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01336 tRNA_anti-codon: OB-fold nucleic acid binding domain; InterPro: IPR004365 The OB-fold (oligonucleotide/oligosaccharide-binding fold) is found in all three kingdoms and its common architecture presents a binding face that has adapted to bind different ligands Back     alignment and domain information
>cd04484 polC_OBF polC_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold nucleic acid binding domain of Bacillus subtilis type C replicative DNA polymerase III alpha subunit (polC) Back     alignment and domain information
>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ Back     alignment and domain information
>cd04474 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds corresponding to the second OB fold, the ssDNA-binding domain (DBD)-A, of human RPA1 (also called RPA70) Back     alignment and domain information
>cd04492 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds similar to that found in Bacillus subtilis YhaM and Staphylococcus aureus cmp-binding factor-1 (SaCBF1) Back     alignment and domain information
>cd04489 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit Back     alignment and domain information
>cd04485 DnaE_OBF DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE) Back     alignment and domain information
>PRK13480 3'-5' exoribonuclease YhaM; Provisional Back     alignment and domain information
>PRK15491 replication factor A; Provisional Back     alignment and domain information
>PRK07211 replication factor A; Reviewed Back     alignment and domain information
>PRK15491 replication factor A; Provisional Back     alignment and domain information
>cd04482 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacterized archaeal OB folds with similarity to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>PRK07211 replication factor A; Reviewed Back     alignment and domain information
>PF11325 DUF3127: Domain of unknown function (DUF3127); InterPro: IPR021474 This bacterial family of proteins has no known function Back     alignment and domain information
>cd04488 RecG_wedge_OBF RecG_wedge_OBF: A subfamily of OB folds corresponding to the OB fold found in the N-terminal (wedge) domain of Escherichia coli RecG Back     alignment and domain information
>cd03524 RPA2_OBF_family RPA2_OBF_family: A family of oligonucleotide binding (OB) folds with similarity to the OB fold of the single strand (ss) DNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>PRK06461 single-stranded DNA-binding protein; Reviewed Back     alignment and domain information
>cd04490 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds corresponding to the OB fold found in Pyrococcus abyssi DNA polymerase II (PolII) small subunit Back     alignment and domain information
>PRK14699 replication factor A; Provisional Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>cd04491 SoSSB_OBF SoSSB_OBF: A subfamily of OB folds similar to the OB fold of the crenarchaeote Sulfolobus solfataricus single-stranded (ss) DNA-binding protein (SSoSSB) Back     alignment and domain information
>PRK12366 replication factor A; Reviewed Back     alignment and domain information
>PF13742 tRNA_anti_2: OB-fold nucleic acid binding domain Back     alignment and domain information
>COG3390 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR00617 rpa1 replication factor-a protein 1 (rpa1) Back     alignment and domain information
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>PRK12366 replication factor A; Reviewed Back     alignment and domain information
>PRK07373 DNA polymerase III subunit alpha; Reviewed Back     alignment and domain information
>PRK08402 replication factor A; Reviewed Back     alignment and domain information
>PRK14699 replication factor A; Provisional Back     alignment and domain information
>cd04475 RPA1_DBD_B RPA1_DBD_B: A subfamily of OB folds corresponding to the third OB fold, the ssDNA-binding domain (DBD)-B, of human RPA1 (also called RPA70) Back     alignment and domain information
>PF11506 DUF3217: Protein of unknown function (DUF3217); InterPro: IPR024506 This family of proteins with unknown function appears to be restricted to Mycoplasma Back     alignment and domain information
>PRK05673 dnaE DNA polymerase III subunit alpha; Validated Back     alignment and domain information
>PRK06826 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type Back     alignment and domain information
>PRK06920 dnaE DNA polymerase III DnaE; Reviewed Back     alignment and domain information
>PRK00448 polC DNA polymerase III PolC; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
1eyg_A116 Crystal Structure Of Chymotryptic Fragment Of E. Co 1e-07
1eqq_A178 Single Stranded Dna Binding Protein And Ssdna Compl 1e-07
1kaw_A135 Structure Of Single Stranded Dna Binding Protein (S 1e-07
1qvc_A145 Crystal Structure Analysis Of Single Stranded Dna B 1e-07
1sru_A113 Crystal Structure Of Full Length E. Coli Ssb Protei 1e-07
3ulp_A124 Plasmodium Falciparum Ssb Complex With Ssdna Length 2e-07
3tqy_A158 Structure Of A Single-Stranded Dna-Binding Protein 6e-07
3ull_A132 Human Mitochondrial Single-Stranded Dna Binding Pro 4e-06
3lgj_A169 Crystal Structure Of Single-Stranded Binding Protei 4e-06
2dud_A133 Crystal Structure Of Human Mitochondrial Single-Str 4e-06
3pgz_A193 Crystal Structure Of A Single Strand Binding Protei 4e-05
>pdb|1EYG|A Chain A, Crystal Structure Of Chymotryptic Fragment Of E. Coli Ssb Bound To Two 35-Mer Single Strand Dnas Length = 116 Back     alignment and structure 
Iteration: 1

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 59/114 (51%), Gaps = 4/114 (3%)
Query: 48  RGVHKAIICGKVKDTPVQKILRNGKTVTIFSVGTGGLFDQRIVGSKDLPKPVQWHRIAVH 107
           RGV+K I+ G +   P  + + NG  V   ++ T   +  +  G  ++ +  +WHR+ + 
Sbjct: 4   RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATG--EMKEQTEWHRVVLF 61
Query: 108 NEILGSYAVKQLVKNSSVYVEGDIEIRVYNDSINGEVKNIPEICIRRDGTLRLV 161
            + L   A + L K S VY+EG +  R + D  +G+ +   E+ +   GT++++
Sbjct: 62  GK-LAEVASEYLRKGSQVYIEGQLRTRKWTDQ-SGQDRYTTEVVVNVGGTMQML 113
>pdb|1EQQ|A Chain A, Single Stranded Dna Binding Protein And Ssdna Complex Length = 178 Back     alignment and structure
>pdb|1KAW|A Chain A, Structure Of Single Stranded Dna Binding Protein (Ssb) Length = 135 Back     alignment and structure
>pdb|1QVC|A Chain A, Crystal Structure Analysis Of Single Stranded Dna Binding Protein (Ssb) From E.Coli Length = 145 Back     alignment and structure
>pdb|1SRU|A Chain A, Crystal Structure Of Full Length E. Coli Ssb Protein Length = 113 Back     alignment and structure
>pdb|3ULP|A Chain A, Plasmodium Falciparum Ssb Complex With Ssdna Length = 124 Back     alignment and structure
>pdb|3TQY|A Chain A, Structure Of A Single-Stranded Dna-Binding Protein (Ssb), From Coxiella Burnetii Length = 158 Back     alignment and structure
>pdb|3ULL|A Chain A, Human Mitochondrial Single-Stranded Dna Binding Protein Length = 132 Back     alignment and structure
>pdb|3LGJ|A Chain A, Crystal Structure Of Single-Stranded Binding Protein (Ssb) From Bartonella Henselae Length = 169 Back     alignment and structure
>pdb|2DUD|A Chain A, Crystal Structure Of Human Mitochondrial Single-Stranded Dna-Binding Protein(Hmtssb) Length = 133 Back     alignment and structure
>pdb|3PGZ|A Chain A, Crystal Structure Of A Single Strand Binding Protein (Ssb) From Bartonella Henselae Length = 193 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
3ull_A132 DNA binding protein; DNA replication, mitochondrio 7e-11
1qvc_A145 Single stranded DNA binding protein monomer; beta- 2e-10
3ulp_A124 Single-strand binding protein; OB-fold, DNA bindin 3e-10
3pgz_A193 Single-stranded DNA-binding protein; ssgcid, singl 7e-10
3lgj_A169 Single-stranded DNA-binding protein; niaid, CAT sc 8e-10
1eqq_A178 Single stranded DNA binding protein; beta barrel, 1e-09
3tqy_A158 Single-stranded DNA-binding protein; DNA replicati 7e-08
1z9f_A153 Single-strand binding protein; TM0604, single stra 3e-07
3k7u_C148 MP18 RNA editing complex protein; OB-fold, RNA-edi 3e-07
1se8_A 301 Single-strand binding protein; DNA binding protein 2e-06
1se8_A301 Single-strand binding protein; DNA binding protein 9e-04
2fxq_A 264 Single-strand binding protein; strand beta-sheet e 3e-06
2fxq_A264 Single-strand binding protein; strand beta-sheet e 1e-04
2vw9_A134 Single-stranded DNA binding protein; DNA replicati 2e-05
3vdy_A116 SSB, single-stranded DNA-binding protein SSBB; OB 3e-05
3k81_C164 MP18 RNA editing complex protein; krepa6, single d 7e-05
3eiv_A199 Single-stranded DNA-binding protein 2; DNA damage, 9e-05
3afp_A168 Single-stranded DNA-binding protein; OB-fold, quat 1e-04
>3ull_A DNA binding protein; DNA replication, mitochondrion, transit peptide; HET: DNA; 2.40A {Homo sapiens} SCOP: b.40.4.3 PDB: 1s3o_A* 2dud_A Length = 132 Back     alignment and structure
 Score = 56.2 bits (136), Expect = 7e-11
 Identities = 30/106 (28%), Positives = 50/106 (47%), Gaps = 4/106 (3%)

Query: 48  RGVHKAIICGKVKDTPVQKILRNGKTVTIFSVGTGGLF---DQRIVGSKDLPKPVQWHRI 104
           R +++  + G+V   PV + +     VTIFS+ T  ++   D  +    D+ +   WHRI
Sbjct: 12  RSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRI 71

Query: 105 AVHNEILGSYAVKQLVKNSSVYVEGDIEIRVYNDSINGEVKNIPEI 150
           +V    L   A + + K S +Y+EG I+   Y D  N   +    I
Sbjct: 72  SVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDK-NNVRRQATTI 116
>1qvc_A Single stranded DNA binding protein monomer; beta-barrel; 2.20A {Escherichia coli} SCOP: b.40.4.3 PDB: 1kaw_A 1eyg_A 1sru_A Length = 145 Back     alignment and structure
>3ulp_A Single-strand binding protein; OB-fold, DNA binding, single-stranded DNA, apicoplast, DNA B protein-DNA complex; HET: DNA; 2.10A {Plasmodium falciparum} Length = 124 Back     alignment and structure
>3pgz_A Single-stranded DNA-binding protein; ssgcid, single-strand binding protein, structural genomics center for infectious disease; 2.10A {Bartonella henselae} Length = 193 Back     alignment and structure
>3lgj_A Single-stranded DNA-binding protein; niaid, CAT scratch fever, rochalimaea, LYME disease, ALS collaborative crystallography, DNA replication; 2.50A {Bartonella henselae} Length = 169 Back     alignment and structure
>1eqq_A Single stranded DNA binding protein; beta barrel, protein-DNA complex, replication/RNA complex; HET: 5MU; 3.20A {Escherichia coli} SCOP: b.40.4.3 Length = 178 Back     alignment and structure
>3tqy_A Single-stranded DNA-binding protein; DNA replication, transferase; 2.60A {Coxiella burnetii} Length = 158 Back     alignment and structure
>1z9f_A Single-strand binding protein; TM0604, single stranded DNA-binding protein, structural GENO joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima} Length = 153 Back     alignment and structure
>3k7u_C MP18 RNA editing complex protein; OB-fold, RNA-editing proteins, kinetoplastids, system, RNA binding protein; 2.10A {Trypanosoma brucei} PDB: 3k80_D 3stb_D Length = 148 Back     alignment and structure
>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3 Length = 301 Back     alignment and structure
>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3 Length = 301 Back     alignment and structure
>2fxq_A Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Length = 264 Back     alignment and structure
>2fxq_A Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Length = 264 Back     alignment and structure
>2vw9_A Single-stranded DNA binding protein; DNA replication, single-stranded DNA, single-stranded DNA binding protein, oligonucleotide/oligosaccharide binding fold, OB-fold; 2.30A {Helicobacter pylori} Length = 134 Back     alignment and structure
>3vdy_A SSB, single-stranded DNA-binding protein SSBB; OB fold; 2.80A {Bacillus subtilis} Length = 116 Back     alignment and structure
>3k81_C MP18 RNA editing complex protein; krepa6, single domain antibody, immune system, RNA BIND protein; 3.40A {Trypanosoma brucei} Length = 164 Back     alignment and structure
>3eiv_A Single-stranded DNA-binding protein 2; DNA damage, DNA repair, DNA replication, phosphoprotein; 2.14A {Streptomyces coelicolor} Length = 199 Back     alignment and structure
>3afp_A Single-stranded DNA-binding protein; OB-fold, quaternary structure and stability, changes on oligomerisation, water-bridges, DNA damage; 2.05A {Mycobacterium leprae} PDB: 3afq_A 1ue1_A 1ue5_A 1ue6_A 1ue7_A 1x3e_A 1x3f_A 1x3g_A 3a5u_A* Length = 168 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
3ulp_A124 Single-strand binding protein; OB-fold, DNA bindin 100.0
3tqy_A158 Single-stranded DNA-binding protein; DNA replicati 99.97
1qvc_A145 Single stranded DNA binding protein monomer; beta- 99.97
3vdy_A116 SSB, single-stranded DNA-binding protein SSBB; OB 99.97
3lgj_A169 Single-stranded DNA-binding protein; niaid, CAT sc 99.97
3pgz_A193 Single-stranded DNA-binding protein; ssgcid, singl 99.97
2vw9_A134 Single-stranded DNA binding protein; DNA replicati 99.97
1z9f_A153 Single-strand binding protein; TM0604, single stra 99.97
3ull_A132 DNA binding protein; DNA replication, mitochondrio 99.97
3k7u_C148 MP18 RNA editing complex protein; OB-fold, RNA-edi 99.97
3afp_A168 Single-stranded DNA-binding protein; OB-fold, quat 99.97
1eqq_A178 Single stranded DNA binding protein; beta barrel, 99.97
3koj_A108 Uncharacterized protein YCF41; single-strand bindi 99.97
4dam_A128 Single-stranded DNA-binding protein 1; OB-fold; 1. 99.97
3k81_C164 MP18 RNA editing complex protein; krepa6, single d 99.96
3eiv_A199 Single-stranded DNA-binding protein 2; DNA damage, 99.96
1v1q_A134 Primosomal replication protein N; primosome, DNA r 99.95
1se8_A 301 Single-strand binding protein; DNA binding protein 99.95
2fxq_A264 Single-strand binding protein; strand beta-sheet e 99.95
4dni_A257 Fusion protein of RNA-editing complex proteins MP 99.94
2fxq_A 264 Single-strand binding protein; strand beta-sheet e 99.94
1se8_A301 Single-strand binding protein; DNA binding protein 99.94
1txy_A104 Primosomal replication protein N; OB fold, dimer, 99.94
3k8a_A103 Putative primosomal replication protein; beta-barr 99.92
4gs3_A107 Single-stranded DNA-binding protein; primosome, ol 99.92
3fhw_A115 Primosomal replication protein N; PRIB BPR162 X-RA 99.92
3en2_A101 Probable primosomal replication protein N; PRIB RS 99.87
3stb_C148 RNA-editing complex protein MP42; editosome, nanob 99.85
4dni_A 257 Fusion protein of RNA-editing complex proteins MP 99.83
4dka_C105 RNA-editing complex protein MP81; krepa1, VHH, sin 97.71
3dm3_A105 Replication factor A; probably plays AN essential 96.45
3e0e_A97 Replication protein A; structural genomics, PSI-2, 96.26
2k75_A106 Uncharacterized protein TA0387; closed beta barrel 96.13
1o7i_A119 SSB, SSO2364, single stranded DNA binding protein; 95.87
2k50_A115 Replication factor A related protein; uncharacteri 95.86
1ynx_A114 Replication factor-A protein 1; canonical OB fold, 95.7
1jmc_A 246 Protein (replication protein A (RPA)); human ssDNA 94.25
4gop_C 444 Putative uncharacterized protein; OB fold, ssDNA b 91.37
3f2b_A 1041 DNA-directed DNA polymerase III alpha chain; DNA p 90.1
3au7_A402 TIAS, putative uncharacterized protein; ATP hydrol 88.83
3kdf_D132 Replication protein A 32 kDa subunit; wheat GERM c 88.26
2hql_A110 Hypothetical protein Mg376 homolog; structural gen 85.78
4gop_B136 Putative uncharacterized protein; OB fold, ssDNA b 84.95
1ltl_A279 DNA replication initiator (CDC21/CDC54); HET: DNA; 84.03
2pi2_A270 Replication protein A 32 kDa subunit; FULL-length 82.69
2kbn_A109 Conserved protein; nucleic acid binding protein, b 82.4
2vl6_A268 SSO MCM N-TER, minichromosome maintenance protein 81.25
>3ulp_A Single-strand binding protein; OB-fold, DNA binding, single-stranded DNA, apicoplast, DNA B protein-DNA complex; HET: DNA; 2.10A {Plasmodium falciparum} Back     alignment and structure
Probab=100.00  E-value=3e-32  Score=206.73  Aligned_cols=117  Identities=28%  Similarity=0.480  Sum_probs=101.8

Q ss_pred             ccccEEEEEEEeCCCCeEEEecCCeEEEEEEEEECCceeccCCCcccCCCCceEEEEEecC-chhHHHHHHhcCCCCeEE
Q 030281           48 RGVHKAIICGKVKDTPVQKILRNGKTVTIFSVGTGGLFDQRIVGSKDLPKPVQWHRIAVHN-EILGSYAVKQLVKNSSVY  126 (180)
Q Consensus        48 ~~mN~v~L~Grlg~dPe~r~t~nG~~v~~fsVa~~~~~~d~~~Ge~~~~~~t~w~~V~~~g-k~~Ae~~~~~l~KG~~V~  126 (180)
                      ++||+|+|+|||++||++|++++|+++++|+||+++.|+++++|++  .+.++||+|++|| + +|+.++++|+||++|+
T Consensus         4 ~~~N~v~l~Grl~~dpelr~t~~G~~v~~f~lA~~~~~~~~~~G~~--~~~t~~~~v~~wg~~-~Ae~~~~~l~KG~~V~   80 (124)
T 3ulp_A            4 KSLNKIMLIGRVGCEPDIKILNGGDKVATFSLATNEFWRDRNTNEL--KSKTDWHRIVVYDQN-IVDLIDKYLRKGRRVY   80 (124)
T ss_dssp             CCEEEEEEEEEECSCCEEEECTTSCEEEEEEEEEEEEEECTTTCCE--EEEEEEEEEEECCHH-HHHHHHHHCCTTCEEE
T ss_pred             ccceEEEEEEEECCCcEEEECCCCCEEEEEEEEEccceecccCCcE--ecccEEEEEEEEEch-HHHHHHhhcCCCCEEE
Confidence            6899999999999999999999999999999999999988756875  4689999999999 7 9999999999999999


Q ss_pred             EEEEeEEeeeecCC-CCeEEEEEEEEEEe-CCceEEecCCCCC
Q 030281          127 VEGDIEIRVYNDSI-NGEVKNIPEICIRR-DGTLRLVKSGESI  167 (180)
Q Consensus       127 VeGrL~~~~y~d~~-dG~~~~~~eI~v~~-~g~i~~l~~k~~~  167 (180)
                      |+|+|+++.|+++. +|++++.++|+|+. .++|+||+++++.
T Consensus        81 V~G~L~~~~~~d~~~dG~~~~~~ev~a~~~g~~i~~l~~k~~~  123 (124)
T 3ulp_A           81 VQGSLHTRKWHTNDMNSQPKQITEIILSYNKGDLIFLDDKRNF  123 (124)
T ss_dssp             EEEEEEEEEECC----CCCEEEEEEEECTTTCEEEECC-----
T ss_pred             EEEEEEeEEEeCCCCCCCEEEEEEEEEEcCCCcEEEecCcCCC
Confidence            99999999999864 79999999999974 4479999998753
>3tqy_A Single-stranded DNA-binding protein; DNA replication, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1qvc_A Single stranded DNA binding protein monomer; beta-barrel; 2.20A {Escherichia coli} SCOP: b.40.4.3 PDB: 1kaw_A 1eyg_A 1sru_A Back     alignment and structure
>3vdy_A SSB, single-stranded DNA-binding protein SSBB; OB fold; 2.80A {Bacillus subtilis} Back     alignment and structure
>3lgj_A Single-stranded DNA-binding protein; niaid, CAT scratch fever, rochalimaea, LYME disease, ALS collaborative crystallography, DNA replication; 2.50A {Bartonella henselae} Back     alignment and structure
>3pgz_A Single-stranded DNA-binding protein; ssgcid, single-strand binding protein, structural genomics center for infectious disease; 2.10A {Bartonella henselae} Back     alignment and structure
>2vw9_A Single-stranded DNA binding protein; DNA replication, single-stranded DNA, single-stranded DNA binding protein, oligonucleotide/oligosaccharide binding fold, OB-fold; 2.30A {Helicobacter pylori} Back     alignment and structure
>1z9f_A Single-strand binding protein; TM0604, single stranded DNA-binding protein, structural GENO joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima} Back     alignment and structure
>3ull_A DNA binding protein; DNA replication, mitochondrion, transit peptide; HET: DNA; 2.40A {Homo sapiens} SCOP: b.40.4.3 PDB: 1s3o_A* 2dud_A Back     alignment and structure
>3k7u_C MP18 RNA editing complex protein; OB-fold, RNA-editing proteins, kinetoplastids, system, RNA binding protein; 2.10A {Trypanosoma brucei} PDB: 3k80_D 3stb_D Back     alignment and structure
>3afp_A Single-stranded DNA-binding protein; OB-fold, quaternary structure and stability, changes on oligomerisation, water-bridges, DNA damage; 2.05A {Mycobacterium leprae} PDB: 3afq_A 1ue1_A 1ue5_A 1ue6_A 1ue7_A 1x3e_A 1x3f_A 1x3g_A 3a5u_A* Back     alignment and structure
>1eqq_A Single stranded DNA binding protein; beta barrel, protein-DNA complex, replication/RNA complex; HET: 5MU; 3.20A {Escherichia coli} SCOP: b.40.4.3 Back     alignment and structure
>3koj_A Uncharacterized protein YCF41; single-strand binding protein family, PF00436, SNR59A, NESG, structural genomics, PSI-2; 1.90A {Synechococcus elongatus pcc 6301} Back     alignment and structure
>4dam_A Single-stranded DNA-binding protein 1; OB-fold; 1.70A {Streptomyces coelicolor} Back     alignment and structure
>3k81_C MP18 RNA editing complex protein; krepa6, single domain antibody, immune system, RNA BIND protein; 3.40A {Trypanosoma brucei} Back     alignment and structure
>3eiv_A Single-stranded DNA-binding protein 2; DNA damage, DNA repair, DNA replication, phosphoprotein; 2.14A {Streptomyces coelicolor} Back     alignment and structure
>1v1q_A Primosomal replication protein N; primosome, DNA replication, DNA binding; 2.1A {Escherichia coli} SCOP: b.40.4.3 PDB: 2ccz_A Back     alignment and structure
>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3 Back     alignment and structure
>2fxq_A Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Back     alignment and structure
>4dni_A Fusion protein of RNA-editing complex proteins MP MP18; krepa3, krepa6, editosome, protein/RNA binding, protein BIND binding protein; 2.55A {Trypanosoma brucei} Back     alignment and structure
>2fxq_A Single-strand binding protein; strand beta-sheet extended loops, DNA binding protein; 1.85A {Thermus aquaticus} PDB: 2ihe_A 2cwa_A 2ihf_A Back     alignment and structure
>1se8_A Single-strand binding protein; DNA binding protein; 1.80A {Deinococcus radiodurans} SCOP: b.40.4.3 Back     alignment and structure
>1txy_A Primosomal replication protein N; OB fold, dimer, DNA binding protein; 2.00A {Escherichia coli} SCOP: b.40.4.3 PDB: 1woc_A 2pnh_A 4apv_A Back     alignment and structure
>3k8a_A Putative primosomal replication protein; beta-barrel, OB-fold, DNA binding protein; 2.70A {Neisseria gonorrhoeae fa 1090} Back     alignment and structure
>4gs3_A Single-stranded DNA-binding protein; primosome, oligonucleotide/oligosaccharide binding domain, D binding protein; 1.09A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3fhw_A Primosomal replication protein N; PRIB BPR162 X-RAY NESG, structural genomics, PSI-2, protein initiative; 1.90A {Bordetella parapertussis} PDB: 3dm4_A 3klw_A Back     alignment and structure
>3en2_A Probable primosomal replication protein N; PRIB RSR213C NESG X-RAY Q8XZT7 Q8XZT7_ralso, structural genomics, PSI-2; 2.30A {Ralstonia solanacearum} Back     alignment and structure
>3stb_C RNA-editing complex protein MP42; editosome, nanobody, single domain antibody, VH krepa3, krepa6, RNA binding protein-immune system complex; 2.50A {Trypanosoma brucei} Back     alignment and structure
>4dni_A Fusion protein of RNA-editing complex proteins MP MP18; krepa3, krepa6, editosome, protein/RNA binding, protein BIND binding protein; 2.55A {Trypanosoma brucei} Back     alignment and structure
>4dka_C RNA-editing complex protein MP81; krepa1, VHH, single domain antibody, protein binding, RNA BI protein-immune system complex; 1.97A {Trypanosoma brucei} PDB: 4dk3_C 4dk6_C Back     alignment and structure
>3dm3_A Replication factor A; probably plays AN essential for replication of the chromosome, DNA recombination and repair; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>3e0e_A Replication protein A; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Methanococcus maripaludis} PDB: 2k5v_A Back     alignment and structure
>2k75_A Uncharacterized protein TA0387; closed beta barrel, OB fold, structural genomics, PSI-2, protein structure initiative; NMR {Thermoplasma acidophilum} Back     alignment and structure
>1o7i_A SSB, SSO2364, single stranded DNA binding protein; OB fold; 1.2A {Sulfolobus solfataricus} SCOP: b.40.4.3 Back     alignment and structure
>2k50_A Replication factor A related protein; uncharacterized protein, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>1ynx_A Replication factor-A protein 1; canonical OB fold, DNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1jmc_A Protein (replication protein A (RPA)); human ssDNA binding replication protein A(RPA), single stranded DNA-binding protein, protein-ssDNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: b.40.4.3 b.40.4.3 PDB: 1fgu_A Back     alignment and structure
>4gop_C Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis} Back     alignment and structure
>3f2b_A DNA-directed DNA polymerase III alpha chain; DNA polymerase C, DNA polymerase III; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A* Back     alignment and structure
>3au7_A TIAS, putative uncharacterized protein; ATP hydrolysis, RNA binding protein; 2.60A {Archaeoglobus fulgidus} PDB: 3amt_A* 3amu_A* Back     alignment and structure
>3kdf_D Replication protein A 32 kDa subunit; wheat GERM cell free, protein complex, center for eukaryotic structural genomics, PSI; HET: MSE; 1.98A {Homo sapiens} SCOP: b.40.4.3 PDB: 2pqa_A 1quq_A 1l1o_B Back     alignment and structure
>2hql_A Hypothetical protein Mg376 homolog; structural genomics, conserved hypothetical protein, GI:1673959, MPN554, OB fold; 2.00A {Mycoplasma pneumoniae} Back     alignment and structure
>4gop_B Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis} Back     alignment and structure
>1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11 Back     alignment and structure
>2pi2_A Replication protein A 32 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxan replication, DNA binding protein; 2.00A {Homo sapiens} SCOP: b.40.4.3 PDB: 2z6k_A 1dpu_A 1z1d_A Back     alignment and structure
>2kbn_A Conserved protein; nucleic acid binding protein, beta barrel, structural genomics, PSI-2, protein structure initiative; NMR {Methanosarcina mazei} PDB: 2ken_A Back     alignment and structure
>2vl6_A SSO MCM N-TER, minichromosome maintenance protein MCM; helicase, hydrolase, zinc-finger, ATP-binding, DNA-BIND ssDNA binding; 2.8A {Sulfolobus solfataricus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 180
d1qvca_145 b.40.4.3 (A:) ssDNA-binding protein {Escherichia c 5e-12
d1se8a_ 231 b.40.4.3 (A:) ssDNA-binding protein {Deinococcus r 2e-11
d1se8a_231 b.40.4.3 (A:) ssDNA-binding protein {Deinococcus r 5e-08
d1ue1a_118 b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium 5e-07
d3ulla_115 b.40.4.3 (A:) ssDNA-binding protein {Human (Homo s 8e-06
>d1qvca_ b.40.4.3 (A:) ssDNA-binding protein {Escherichia coli [TaxId: 562]} Length = 145 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Single strand DNA-binding domain, SSB
domain: ssDNA-binding protein
species: Escherichia coli [TaxId: 562]

 Score = 58.6 bits (141), Expect = 5e-12
 Identities = 30/119 (25%), Positives = 58/119 (48%), Gaps = 4/119 (3%)

Query: 48  RGVHKAIICGKVKDTPVQKILRNGKTVTIFSVGTGGLFDQRIVGSKDLPKPVQWHRIAVH 107
           RGV+K I+ G +   P  + + NG  V   ++ T      R   + ++ +  +WHR+ + 
Sbjct: 3   RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSE--SWRDKATGEMKEQTEWHRVVLF 60

Query: 108 NEILGSYAVKQLVKNSSVYVEGDIEIRVYNDSINGEVKNIPEICIRRDGTLRLVKSGES 166
              L   A + L K S VY+EG +  R + D  +G+ +   E+ +   GT++++   + 
Sbjct: 61  G-KLAEVASEYLRKGSQVYIEGQLRTRKWTDQ-SGQDRYTTEVVVNVGGTMQMLGGRQG 117
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} Length = 231 Back     information, alignment and structure
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} Length = 231 Back     information, alignment and structure
>d1ue1a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} Length = 118 Back     information, alignment and structure
>d3ulla_ b.40.4.3 (A:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
d1qvca_145 ssDNA-binding protein {Escherichia coli [TaxId: 56 99.98
d3ulla_115 ssDNA-binding protein {Human (Homo sapiens), mitoc 99.97
d1ue1a_118 ssDNA-binding protein {Mycobacterium tuberculosis 99.96
d1se8a_231 ssDNA-binding protein {Deinococcus radiodurans [Ta 99.96
d1se8a_ 231 ssDNA-binding protein {Deinococcus radiodurans [Ta 99.95
d1v1qa_111 Primosomal replication protein N, PriB {Escherichi 99.93
d1jmca1116 Replication protein A 70 KDa subunit (RPA70) {Huma 96.18
d1o7ia_115 Archaeal ssDNA-binding protein {Archaeon Sulfolobu 95.73
d1wjja_145 Hypothetical protein At4g28440 (F20O9.120) {Thale 87.53
>d1qvca_ b.40.4.3 (A:) ssDNA-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Single strand DNA-binding domain, SSB
domain: ssDNA-binding protein
species: Escherichia coli [TaxId: 562]

Probab=99.98  E-value=6e-32  Score=208.03  Aligned_cols=118  Identities=25%  Similarity=0.527  Sum_probs=106.8

Q ss_pred             ccccEEEEEEEeCCCCeEEEecCCeEEEEEEEEECCceeccCCCcccCCCCceEEEEEecCchhHHHHHHhcCCCCeEEE
Q 030281           48 RGVHKAIICGKVKDTPVQKILRNGKTVTIFSVGTGGLFDQRIVGSKDLPKPVQWHRIAVHNEILGSYAVKQLVKNSSVYV  127 (180)
Q Consensus        48 ~~mN~v~L~Grlg~dPe~r~t~nG~~v~~fsVa~~~~~~d~~~Ge~~~~~~t~w~~V~~~gk~~Ae~~~~~l~KG~~V~V  127 (180)
                      ++||+|+|+|||++||++|++++|+.+++|+||+++.+.+...|++  .+.|+||+|++|++ +|++++++|+||++|+|
T Consensus         3 ~~mN~v~LiG~l~~dpe~r~~~~G~~v~~f~va~~~~~~~~~~~~~--~~~t~w~~v~~~g~-~Ae~~~~~l~KG~~V~V   79 (145)
T d1qvca_           3 RGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEM--KEQTEWHRVVLFGK-LAEVASEYLRKGSQVYI   79 (145)
T ss_dssp             CCEEEEEEEEEESSCCEEECCSSSCCEEEEEEEECCCCSCCSSSSC--CCCCEEEEEEEETH-HHHHHHHHCCTTCEEEE
T ss_pred             CcceEEEEEEECCCCCEEEECCCCCEEEEEEEEecccccccccccc--cccceEEeeEEecc-hhhhHhhhcccCCEEEE
Confidence            6899999999999999999999999999999999998877655554  67999999999999 99999999999999999


Q ss_pred             EEEeEEeeeecCCCCeEEEEEEEEEEeCCceEEecCCCCCCC
Q 030281          128 EGDIEIRVYNDSINGEVKNIPEICIRRDGTLRLVKSGESISK  169 (180)
Q Consensus       128 eGrL~~~~y~d~~dG~~~~~~eI~v~~~g~i~~l~~k~~~~~  169 (180)
                      +|+|+++.|+++ +|++++.++|+|+..+.|++|.++.....
T Consensus        80 ~G~l~~~~~~~k-dG~~r~~~ei~~~~~~~l~~l~~r~~~~~  120 (145)
T d1qvca_          80 EGQLRTRKWTDQ-SGQDRYTTEVVVNVGGTMQMLGGRQGGGA  120 (145)
T ss_dssp             EEEEEEEEECSS-SSCEEEEEEEECTTCEEEECCCCSCCCSS
T ss_pred             EEEEEEeeeECC-CCCEEEEEEEEEecCCcEEECcCccCCCC
Confidence            999999999998 99999999999985557888877754433
>d3ulla_ b.40.4.3 (A:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]} Back     information, alignment and structure
>d1ue1a_ b.40.4.3 (A:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1v1qa_ b.40.4.3 (A:) Primosomal replication protein N, PriB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmca1 b.40.4.3 (A:183-298) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o7ia_ b.40.4.3 (A:) Archaeal ssDNA-binding protein {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wjja_ b.40.4.3 (A:) Hypothetical protein At4g28440 (F20O9.120) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure