Citrus Sinensis ID: 030302


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MIIPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSAKPAGRPMGGPGGDRPRGPPRFDGDRPRFGDREGYRGGPRGGDFGGEKGGAPADFQPSFRGSGGRPGFGRGGGGYGAAPSGSGFP
ccccHHHHHHHHHHHHHccCEEEEcccccccccccccccHHHHHHHHccccHHHHHHHccccEEEEEEccHHHHHHHHHHccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MIIPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPA***********************************************************FQPSFRGSG**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIIPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSAKPAGRPMGGPGGDRPRGPPRFDGDRPRFGDREGYRGGPRGGDFGGEKGGAPADFQPSFRGSGGRPGFGRGGGGYGAAPSGSGFP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein S10 confidentQ9AYP4
40S ribosomal protein S10-1 confidentQ9SW09
40S ribosomal protein S10b probableQ9VWG3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U5C, chain K
Confidence level:very confident
Coverage over the Query: 1-96
View the alignment between query and template
View the model in PyMOL
Template: 2XZM, chain 7
Confidence level:very confident
Coverage over the Query: 2-107
View the alignment between query and template
View the model in PyMOL