Citrus Sinensis ID: 030302

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MIIPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSAKPAGRPMGGPGGDRPRGPPRFDGDRPRFGDREGYRGGPRGGDFGGEKGGAPADFQPSFRGSGGRPGFGRGGGGYGAAPSGSGFP
ccccHHHHHHHHHHHHHccEEEEEcccccccccccccccHHHHHHHHccccHHHHHHHccccEEEEEEccHHHHHHHHHHccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccHHHHHHHHHHHHHcccEEEEcccccccccccccccHHHHHHHHHHHcccccEEEEEEEEEEEEccHHHHHHHHHHHccccHHcHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MIIPEKNRKEICKYLFQEgvcyakkdynlakhpeidvpnLQVIKLMQSFKSREYVRETFAWMHYYWYLTNDGIEFLRTYlnlpseivpatlkksakpagrpmggpggdrprgpprfdgdrprfgdregyrggprggdfggekggapadfqpsfrgsggrpgfgrggggygaapsgsgfp
miipeknrkeICKYLFQEGVCYAKKDYNLAKhpeidvpnlqVIKLMQSFKSREYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPAtlkksakpagrpmggpggdrprgpprfdGDRPRFGDREGYRGGPRGGDFGGEKGGAPADFQPSFRGSGGRPGFGRGGggygaapsgsgfp
MIIPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSAKPAgrpmggpggdrprgpprfdgdrprfgdregyrggprggdfggekggAPADFQpsfrgsggrpgfgrggggygaapsgsgfp
*********EICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVP*******************************************************************************************
MIIPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPA***********************************************************FQPSFRGSG**********************
MIIPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSAKPAGRPMGGPGGDRPRGPPRFDGDRPRFGDREGYRGGPRGGDFGGEKGGAPADFQPSFRGSGGRPGFGRGGGGYGA********
MIIPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKK**************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIIPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFAWMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSAKPAGRPMGGPGGDRPRGPPRFDGDRPRFGDREGYRGGPRGGDFGGEKGGAPADFQPSFRGSGGRPGFGRGGGGYGAAPSGSGFP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query179 2.2.26 [Sep-21-2011]
Q9SW09177 40S ribosomal protein S10 yes no 0.983 0.994 0.85 6e-70
Q9AYP4183 40S ribosomal protein S10 yes no 0.871 0.852 0.861 3e-67
Q9LTF2179 40S ribosomal protein S10 no no 0.994 0.994 0.8 2e-62
Q9FFS8180 40S ribosomal protein S10 no no 0.832 0.827 0.697 3e-52
O77302156 40S ribosomal protein S10 N/A no 0.826 0.948 0.532 7e-36
Q962R9158 40S ribosomal protein S10 N/A no 0.837 0.949 0.502 2e-35
P63326165 40S ribosomal protein S10 yes no 0.765 0.830 0.522 8e-35
P63325165 40S ribosomal protein S10 yes no 0.765 0.830 0.522 8e-35
P46783165 40S ribosomal protein S10 no no 0.765 0.830 0.509 7e-34
Q3T0F4165 40S ribosomal protein S10 yes no 0.765 0.830 0.509 7e-34
>sp|Q9SW09|RS101_ARATH 40S ribosomal protein S10-1 OS=Arabidopsis thaliana GN=RPS10A PE=2 SV=1 Back     alignment and function desciption
 Score =  263 bits (671), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 164/180 (91%), Gaps = 4/180 (2%)

Query: 1   MIIPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFA 60
           MII E NR+EICKYLF+EGVC+AKKD+NL KHP IDVPNLQVIKLMQSFKS+EYVRETFA
Sbjct: 1   MIISENNRREICKYLFKEGVCFAKKDFNLPKHPLIDVPNLQVIKLMQSFKSKEYVRETFA 60

Query: 61  WMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSAKPAGRPMGGPGGDRPRGPPRFDGDR 120
           WMHYYW+LTN+GIEFLRTYLNLPS++VPATLKKSAKP GRP GGP GDR RGPPR DGDR
Sbjct: 61  WMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAKPGGRPFGGPPGDRQRGPPRSDGDR 120

Query: 121 PRFGDREGYRGGPRGGDFGGEKGGAPADFQPSFRGSGGRPGFGRGGGGY-GAAPSGSGFP 179
           PRFGDR+GYRGGPRGGD   EKGGAPADFQPSF+G GGRPGFGRG GGY  AAPSGSGFP
Sbjct: 121 PRFGDRDGYRGGPRGGD---EKGGAPADFQPSFQGGGGRPGFGRGAGGYSAAAPSGSGFP 177

Arabidopsis thaliana (taxid: 3702)
>sp|Q9AYP4|RS10_ORYSJ 40S ribosomal protein S10 OS=Oryza sativa subsp. japonica GN=RPS10 PE=2 SV=2 Back     alignment and function description
>sp|Q9LTF2|RS103_ARATH 40S ribosomal protein S10-3 OS=Arabidopsis thaliana GN=RPS10C PE=2 SV=2 Back     alignment and function description
>sp|Q9FFS8|RS102_ARATH 40S ribosomal protein S10-2 OS=Arabidopsis thaliana GN=RPS10B PE=2 SV=1 Back     alignment and function description
>sp|O77302|RS10_LUMRU 40S ribosomal protein S10 OS=Lumbricus rubellus GN=RPS10 PE=2 SV=1 Back     alignment and function description
>sp|Q962R9|RS10_SPOFR 40S ribosomal protein S10 OS=Spodoptera frugiperda GN=RpS10 PE=2 SV=1 Back     alignment and function description
>sp|P63326|RS10_RAT 40S ribosomal protein S10 OS=Rattus norvegicus GN=Rps10 PE=2 SV=1 Back     alignment and function description
>sp|P63325|RS10_MOUSE 40S ribosomal protein S10 OS=Mus musculus GN=Rps10 PE=1 SV=1 Back     alignment and function description
>sp|P46783|RS10_HUMAN 40S ribosomal protein S10 OS=Homo sapiens GN=RPS10 PE=1 SV=1 Back     alignment and function description
>sp|Q3T0F4|RS10_BOVIN 40S ribosomal protein S10 OS=Bos taurus GN=RPS10 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query179
357163509184 PREDICTED: 40S ribosomal protein S10-lik 0.882 0.858 0.839 8e-71
413918327163 hypothetical protein ZEAMMB73_772347 [Ze 0.860 0.944 0.859 2e-70
413918326166 hypothetical protein ZEAMMB73_772347, pa 0.860 0.927 0.859 2e-70
194702238179 unknown [Zea mays] 0.849 0.849 0.858 2e-69
195623100179 40S ribosomal protein S10 [Zea mays] 0.849 0.849 0.851 7e-69
226498396182 40S ribosomal protein S10 [Zea mays] gi| 0.865 0.851 0.830 2e-68
195653339177 40S ribosomal protein S10 [Zea mays] 0.983 0.994 0.844 3e-68
15235985177 40S ribosomal protein S10-1 [Arabidopsis 0.983 0.994 0.85 3e-68
224030837181 unknown [Zea mays] gi|414587206|tpg|DAA3 0.865 0.856 0.830 3e-68
449452450 505 PREDICTED: uncharacterized protein LOC10 0.837 0.297 0.857 7e-68
>gi|357163509|ref|XP_003579755.1| PREDICTED: 40S ribosomal protein S10-like [Brachypodium distachyon] Back     alignment and taxonomy information
 Score =  271 bits (693), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 136/162 (83%), Positives = 144/162 (88%), Gaps = 4/162 (2%)

Query: 1   MIIPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFA 60
           MII +KNR EICKYLFQEGV YAKKDYNL KHP+IDVPNLQVIKLMQSFKS+EYVRETF+
Sbjct: 1   MIISKKNRNEICKYLFQEGVLYAKKDYNLEKHPQIDVPNLQVIKLMQSFKSKEYVRETFS 60

Query: 61  WMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSAKPAGRPMG-GPGGDRPRGPPR-FDG 118
           W HYYWYLTNDGIE LR +LNLPSEIVPATLKKSA+P GRP G GP GDR RGPPR FDG
Sbjct: 61  WQHYYWYLTNDGIEHLRNFLNLPSEIVPATLKKSARPPGRPFGSGPPGDRSRGPPRDFDG 120

Query: 119 DRPRFGDREGYRGGPRG--GDFGGEKGGAPADFQPSFRGSGG 158
           DRPRFGDR+GYRGGPR   GDFGGEKGGAPA+FQPSFR SG 
Sbjct: 121 DRPRFGDRDGYRGGPRAAPGDFGGEKGGAPAEFQPSFRSSGA 162

Source: Brachypodium distachyon

Species: Brachypodium distachyon

Genus: Brachypodium

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|413918327|gb|AFW58259.1| hypothetical protein ZEAMMB73_772347 [Zea mays] Back     alignment and taxonomy information
>gi|413918326|gb|AFW58258.1| hypothetical protein ZEAMMB73_772347, partial [Zea mays] Back     alignment and taxonomy information
>gi|194702238|gb|ACF85203.1| unknown [Zea mays] Back     alignment and taxonomy information
>gi|195623100|gb|ACG33380.1| 40S ribosomal protein S10 [Zea mays] Back     alignment and taxonomy information
>gi|226498396|ref|NP_001148922.1| 40S ribosomal protein S10 [Zea mays] gi|195623332|gb|ACG33496.1| 40S ribosomal protein S10 [Zea mays] Back     alignment and taxonomy information
>gi|195653339|gb|ACG46137.1| 40S ribosomal protein S10 [Zea mays] Back     alignment and taxonomy information
>gi|15235985|ref|NP_194304.1| 40S ribosomal protein S10-1 [Arabidopsis thaliana] gi|20139845|sp|Q9SW09.1|RS101_ARATH RecName: Full=40S ribosomal protein S10-1 gi|4539292|emb|CAB39595.1| putative ribosomal protein S10 [Arabidopsis thaliana] gi|7269424|emb|CAB81384.1| putative ribosomal protein S10 [Arabidopsis thaliana] gi|14334536|gb|AAK59676.1| putative ribosomal protein S10 [Arabidopsis thaliana] gi|21281207|gb|AAM44974.1| putative ribosomal protein S10 [Arabidopsis thaliana] gi|332659707|gb|AEE85107.1| 40S ribosomal protein S10-1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224030837|gb|ACN34494.1| unknown [Zea mays] gi|414587206|tpg|DAA37777.1| TPA: 40S ribosomal protein S10 [Zea mays] Back     alignment and taxonomy information
>gi|449452450|ref|XP_004143972.1| PREDICTED: uncharacterized protein LOC101214080 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query179
TAIR|locus:2117497177 AT4G25740 "AT4G25740" [Arabido 0.541 0.548 0.865 6e-46
TAIR|locus:2149579179 AT5G52650 [Arabidopsis thalian 0.541 0.541 0.886 4.4e-45
TAIR|locus:2160452180 RPS10B "AT5G41520" [Arabidopsi 0.541 0.538 0.806 1.8e-39
UNIPROTKB|E1C4N0165 RPS10 "Uncharacterized protein 0.525 0.569 0.618 5.6e-29
UNIPROTKB|G5E6M8181 RPS10 "40S ribosomal protein S 0.525 0.519 0.618 5.6e-29
UNIPROTKB|Q3T0F4165 RPS10 "40S ribosomal protein S 0.525 0.569 0.618 5.6e-29
UNIPROTKB|P46783165 RPS10 "40S ribosomal protein S 0.525 0.569 0.618 5.6e-29
UNIPROTKB|F1RZ28165 RPS10 "Uncharacterized protein 0.525 0.569 0.618 5.6e-29
MGI|MGI:1914347165 Rps10 "ribosomal protein S10" 0.525 0.569 0.618 5.6e-29
RGD|621024165 Rps10 "ribosomal protein S10" 0.525 0.569 0.618 5.6e-29
TAIR|locus:2117497 AT4G25740 "AT4G25740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 467 (169.5 bits), Expect = 6.0e-46, Sum P(2) = 6.0e-46
 Identities = 84/97 (86%), Positives = 93/97 (95%)

Query:     1 MIIPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFA 60
             MII E NR+EICKYLF+EGVC+AKKD+NL KHP IDVPNLQVIKLMQSFKS+EYVRETFA
Sbjct:     1 MIISENNRREICKYLFKEGVCFAKKDFNLPKHPLIDVPNLQVIKLMQSFKSKEYVRETFA 60

Query:    61 WMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSAKP 97
             WMHYYW+LTN+GIEFLRTYLNLPS++VPATLKKSAKP
Sbjct:    61 WMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAKP 97
GO:0003735 "structural constituent of ribosome" evidence=ISS
GO:0006412 "translation" evidence=ISS
GO:0022627 "cytosolic small ribosomal subunit" evidence=ISS;IDA
GO:0022626 "cytosolic ribosome" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009664 "plant-type cell wall organization" evidence=RCA
GO:0042545 "cell wall modification" evidence=RCA
TAIR|locus:2149579 AT5G52650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160452 RPS10B "AT5G41520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4N0 RPS10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G5E6M8 RPS10 "40S ribosomal protein S10" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0F4 RPS10 "40S ribosomal protein S10" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P46783 RPS10 "40S ribosomal protein S10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZ28 RPS10 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1914347 Rps10 "ribosomal protein S10" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621024 Rps10 "ribosomal protein S10" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O13614RS10B_SCHPONo assigned EC number0.49370.80440.9795yesno
Q962R9RS10_SPOFRNo assigned EC number0.50290.83790.9493N/Ano
Q9SW09RS101_ARATHNo assigned EC number0.850.98320.9943yesno
Q9AYP4RS10_ORYSJNo assigned EC number0.86160.87150.8524yesno
Q9VWG3RS10B_DROMENo assigned EC number0.50590.86030.9625yesno
Q3T0F4RS10_BOVINNo assigned EC number0.50950.76530.8303yesno
O77302RS10_LUMRUNo assigned EC number0.53290.82680.9487N/Ano
P63325RS10_MOUSENo assigned EC number0.52220.76530.8303yesno
P63326RS10_RATNo assigned EC number0.52220.76530.8303yesno
Q9LTF2RS103_ARATHNo assigned EC number0.80.99440.9944nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query179
pfam0350196 pfam03501, S10_plectin, Plectin/S10 domain 2e-64
PTZ00034124 PTZ00034, PTZ00034, 40S ribosomal protein S10; Pro 3e-48
COG5045105 COG5045, COG5045, Ribosomal protein S10E [Translat 2e-41
PTZ00146 293 PTZ00146, PTZ00146, fibrillarin; Provisional 0.003
PTZ00146 293 PTZ00146, PTZ00146, fibrillarin; Provisional 0.004
>gnl|CDD|190664 pfam03501, S10_plectin, Plectin/S10 domain Back     alignment and domain information 
 Score =  192 bits (490), Expect = 2e-64
 Identities = 70/95 (73%), Positives = 82/95 (86%)

Query: 3  IPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFAWM 62
          IP+ NR+ I +YLF+EGV  AKKD+NL KHPEIDVPNLQVIK MQS KSR YV+E FAW 
Sbjct: 1  IPKANRRAIYEYLFKEGVLVAKKDFNLPKHPEIDVPNLQVIKAMQSLKSRGYVKEQFAWR 60

Query: 63 HYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSAKP 97
          HYYWYLTN+GIE+LR YL+LP+E+VPATLKK A+P
Sbjct: 61 HYYWYLTNEGIEYLREYLHLPAEVVPATLKKPARP 95

This presumed domain is found at the N-terminus of some isoforms of the cytoskeletal muscle protein plectin as well as the ribosomal S10 protein. This domain may be involved in RNA binding. Length = 96
>gnl|CDD|173331 PTZ00034, PTZ00034, 40S ribosomal protein S10; Provisional Back     alignment and domain information
>gnl|CDD|227378 COG5045, COG5045, Ribosomal protein S10E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 179
KOG3344150 consensus 40s ribosomal protein s10 [Translation, 100.0
PTZ00034124 40S ribosomal protein S10; Provisional 100.0
PF0350195 S10_plectin: Plectin/S10 domain; InterPro: IPR0053 100.0
COG5045105 Ribosomal protein S10E [Translation, ribosomal str 100.0
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 95.11
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 93.79
PRK10141117 DNA-binding transcriptional repressor ArsR; Provis 93.75
PRK03902142 manganese transport transcriptional regulator; Pro 93.7
PF0355175 PadR: Transcriptional regulator PadR-like family; 93.64
PF1494777 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ 93.52
PLN02853 492 Probable phenylalanyl-tRNA synthetase alpha chain 93.13
PRK04172 489 pheS phenylalanyl-tRNA synthetase subunit alpha; P 93.01
PTZ00326 494 phenylalanyl-tRNA synthetase alpha chain; Provisio 92.9
PF02002105 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024 92.61
PF1360180 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 92.56
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 92.33
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 91.24
COG343295 Predicted transcriptional regulator [Transcription 90.23
PRK05638442 threonine synthase; Validated 89.52
TIGR02702203 SufR_cyano iron-sulfur cluster biosynthesis transc 89.02
TIGR0264777 DNA conserved hypothetical protein TIGR02647. Memb 88.51
PHA00738108 putative HTH transcription regulator 88.23
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 88.21
PF13814191 Replic_Relax: Replication-relaxation 87.98
TIGR02337118 HpaR homoprotocatechuate degradation operon regula 87.88
PRK14165217 winged helix-turn-helix domain-containing protein/ 87.04
PF1433892 Mrr_N: Mrr N-terminal domain 86.71
PF0963988 YjcQ: YjcQ protein; InterPro: IPR018597 YjcQ is a 85.6
PRK09416135 lstR lineage-specific thermal regulator protein; P 85.31
PRK06266178 transcription initiation factor E subunit alpha; V 85.01
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 83.87
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 81.33
>KOG3344 consensus 40s ribosomal protein s10 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=4.5e-74  Score=460.58  Aligned_cols=148  Identities=64%  Similarity=1.125  Sum_probs=129.2

Q ss_pred             CccchhhHHHHHHHhhhcccEEEeecCCCCCCCccccCCHHHHHHhhhcccccccceeeeceeeeeeechhhHHHHHHhh
Q 030302            1 MIIPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFAWMHYYWYLTNDGIEFLRTYL   80 (179)
Q Consensus         1 MlipK~nr~~IYe~LFkEGV~VakKD~~~p~Hpel~VpNL~ViK~mqSLkSrGyVkEqFaWrh~Yw~LTneGI~YLR~yL   80 (179)
                      |||||+||++|||+||||||||||||+++++||||+||||||||+||||+|||||||||||||||||||||||+|||+||
T Consensus         1 Mlipk~nr~~I~e~Lfkegv~vakkD~~~~kH~el~vpNL~vikaMQSl~SrgYvkeqfaWrH~Yw~LTneGi~yLR~YL   80 (150)
T KOG3344|consen    1 MLIPKANRKAIYEYLFKEGVLVAKKDFNLPKHPELEVPNLHVIKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIEYLREYL   80 (150)
T ss_pred             CCcchHHHHHHHHHHHHhcceeeccccCCccCcccCCccHHHHHHHHHHhhhhhHHhhhhhheeeeeechhHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCccccccccCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCccccCCCCCCCCCCCCCCCCCCCCCcccccCCCC
Q 030302           81 NLPSEIVPATLKKSAKPAGRPMG-GPGGDRPRGPPRFDGDRPRFGDREGYRGGPRGGDFGGEKGGAPADFQPSFRGSGGR  159 (179)
Q Consensus        81 hLP~eiVPaTlk~~~~~~~rp~~-~~~g~r~~~~~r~~~~~~~~~dR~~YRr~~~~~~~~~~k~gag~~~~~~Fr~~~~r  159 (179)
                      |||+||||+||+++++++.||++ +.++.+|.     ++.   .+||++||++++++     ++|||++++|||||    
T Consensus        81 hLP~EiVpaTl~~~rP~~~rpr~~g~e~~~p~-----~~~---r~dR~~yR~~~~~~-----~~gA~s~~~~~frg----  143 (150)
T KOG3344|consen   81 HLPPEIVPATLKRSRPETGRPRPPGLEGRGPA-----DGT---RGDRDGYRRGPVPP-----EGGAGSGTEPQFRG----  143 (150)
T ss_pred             cCCcccccchhhccCCCCCCCCCCCCCCCCcc-----ccc---ccchhhhccCCCCC-----CCCCCccccccccc----
Confidence            99999999999998777788865 33332221     222   27999999988754     56899999999982    


Q ss_pred             CCcCCC
Q 030302          160 PGFGRG  165 (179)
Q Consensus       160 ggfGrG  165 (179)
                      -|||++
T Consensus       144 ~g~g~~  149 (150)
T KOG3344|consen  144 RGFGRP  149 (150)
T ss_pred             cCCCCC
Confidence            255554

>PTZ00034 40S ribosomal protein S10; Provisional Back     alignment and domain information
>PF03501 S10_plectin: Plectin/S10 domain; InterPro: IPR005326 This presumed domain is found at the N terminus of some isoforms of the cytoskeletal muscle protein plectin as well as the ribosomal S10 protein Back     alignment and domain information
>COG5045 Ribosomal protein S10E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>PF03551 PadR: Transcriptional regulator PadR-like family; InterPro: IPR005149 Phenolic acids, also called substituted hydroxycinnamic acids, are abundant in the plant kingdom because they are involved in the structure of plant cell walls and are present in some vacuoles Back     alignment and domain information
>PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A Back     alignment and domain information
>PLN02853 Probable phenylalanyl-tRNA synthetase alpha chain Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase alpha chain; Provisional Back     alignment and domain information
>PF02002 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024550 The general transcription factor TFIIE has an essential role in eukaryotic transcription initiation, together with RNA polymerase II and other general factors Back     alignment and domain information
>PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>COG3432 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR Back     alignment and domain information
>TIGR02647 DNA conserved hypothetical protein TIGR02647 Back     alignment and domain information
>PHA00738 putative HTH transcription regulator Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>PF13814 Replic_Relax: Replication-relaxation Back     alignment and domain information
>TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR Back     alignment and domain information
>PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional Back     alignment and domain information
>PF14338 Mrr_N: Mrr N-terminal domain Back     alignment and domain information
>PF09639 YjcQ: YjcQ protein; InterPro: IPR018597 YjcQ is a protein of approx Back     alignment and domain information
>PRK09416 lstR lineage-specific thermal regulator protein; Provisional Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query179
3u5c_K105 The Structure Of The Eukaryotic Ribosome At 3.0 A R 2e-26
3zey_D172 High-resolution Cryo-electron Microscopy Structure 3e-16
2xzm_7162 Crystal Structure Of The Eukaryotic 40s Ribosomal S 1e-11
>pdb|3U5C|K Chain K, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 40s Subunit, Ribosome A Length = 105 Back     alignment and structure 
Iteration: 1

 Score =  115 bits (287), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 70/98 (71%)
Query: 1  MIIPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSREYVRETFA 60
          M++P+++R +I +YLFQEGV  AKKD+N AKH EID  NL VIK +QS  S+ YV+  F+
Sbjct: 1  MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60
Query: 61 WMHYYWYLTNDGIEFLRTYLNLPSEIVPATLKKSAKPA 98
          W +YY+ LT +G+E+LR YLNLP  IVP T  +   P 
Sbjct: 61 WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPT 98
>pdb|3ZEY|D Chain D, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 172 Back     alignment and structure
>pdb|2XZM|7 Chain 7, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 162 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query179
2xzm_7162 Plectin/S10 domain containing protein; ribosome, t 100.0
3u5c_K105 40S ribosomal protein S10-A; translation, ribosome 100.0
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 96.65
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 96.48
3f6o_A118 Probable transcriptional regulator, ARSR family pr 96.33
2oqg_A114 Possible transcriptional regulator, ARSR family P; 96.21
3f6v_A151 Possible transcriptional regulator, ARSR family pr 96.14
3jth_A98 Transcription activator HLYU; transcription factor 96.03
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 95.74
2kko_A108 Possible transcriptional regulatory protein (possi 95.19
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 95.09
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural g 94.78
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 94.75
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH m 94.72
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 94.42
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-he 94.26
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 94.2
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; mul 93.86
2hgc_A102 YJCQ protein; SR346, structure, autostructure, NES 93.62
2gxg_A146 146AA long hypothetical transcriptional regulator; 93.3
2nnn_A140 Probable transcriptional regulator; structural gen 93.29
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 93.09
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 93.07
3df8_A111 Possible HXLR family transcriptional factor; APC89 92.73
3bdd_A142 Regulatory protein MARR; putative multiple antibio 92.68
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 92.64
1r7j_A95 Conserved hypothetical protein SSO10A; winged heli 92.63
2eth_A154 Transcriptional regulator, putative, MAR family; M 92.43
3oop_A143 LIN2960 protein; protein structure initiative, PSI 92.33
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 92.31
2esh_A118 Conserved hypothetical protein TM0937; APC5794, st 92.23
2hr3_A147 Probable transcriptional regulator; MCSG, structur 92.21
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 92.2
3bja_A139 Transcriptional regulator, MARR family, putative; 91.91
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 91.91
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-hel 91.86
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 91.63
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 91.56
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 91.51
3l7w_A108 Putative uncharacterized protein SMU.1704; PADR, t 91.49
1yyv_A131 Putative transcriptional regulator; reductive meth 91.35
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 91.33
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding pr 91.23
3f8b_A116 Transcriptional regulator, PADR-like family; winge 91.06
3cjn_A162 Transcriptional regulator, MARR family; silicibact 91.05
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 90.87
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 90.83
1xma_A145 Predicted transcriptional regulator; southea colla 90.78
2dql_A115 PEX protein; circadian clock associated protein, c 90.74
3elk_A117 Putative transcriptional regulator TA0346; structu 90.67
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 90.58
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 90.54
2pg4_A95 Uncharacterized protein; structural genomics, join 90.46
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 90.35
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 90.17
1s3j_A155 YUSO protein; structural genomics, MARR transcript 90.15
3u2r_A168 Regulatory protein MARR; structural genomics, PSI- 89.97
3boq_A160 Transcriptional regulator, MARR family; MARR famil 89.92
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 89.89
2nyx_A168 Probable transcriptional regulatory protein, RV14; 89.8
2co5_A99 Viral protein F93; viral protein-winged helix comp 89.79
3s2w_A159 Transcriptional regulator, MARR family; structural 89.69
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 89.69
1yg2_A179 Gene activator APHA; virulence factor, winged heli 89.42
3e6m_A161 MARR family transcriptional regulator; APC88769, s 89.38
3hhh_A116 Transcriptional regulator, PADR family; PF03551, s 89.36
4esf_A117 PADR-like transcriptional regulator; PADR family, 89.34
1z91_A147 Organic hydroperoxide resistance transcriptional; 89.3
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 89.25
3f3x_A144 Transcriptional regulator, MARR family, putative; 89.21
1sfx_A109 Conserved hypothetical protein AF2008; structural 89.15
2pex_A153 Transcriptional regulator OHRR; transcription regu 88.96
3u1d_A151 Uncharacterized protein; GNTR-superfamily, structu 88.65
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 88.63
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 88.56
3ech_A142 MEXR, multidrug resistance operon repressor; winge 88.3
1okr_A123 MECI, methicillin resistance regulatory protein ME 88.27
2frh_A127 SARA, staphylococcal accessory regulator A; winged 88.14
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-b 87.88
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 87.77
4esb_A115 Transcriptional regulator, PADR family; DNA bindin 87.66
3l4g_A 508 Phenylalanyl-tRNA synthetase alpha chain; aminoacy 87.49
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 87.39
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 87.36
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 87.21
3kp7_A151 Transcriptional regulator TCAR; multiple drug resi 87.04
1y0u_A96 Arsenical resistance operon repressor, putative; s 86.11
2fsw_A107 PG_0823 protein; alpha-beta structure, helix-turn- 86.06
2e1n_A138 PEX, period extender; circadian clock, DNA binding 85.81
3ri2_A123 Transcriptional regulator, PADR-like family; PSI-b 85.76
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 85.51
2fxa_A207 Protease production regulatory protein HPR; protea 85.37
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 85.35
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 85.1
3nqo_A189 MARR-family transcriptional regulator; structural 83.71
3aaf_A134 Werner syndrome ATP-dependent helicase; helix-turn 83.57
4aik_A151 Transcriptional regulator SLYA; transcription, tra 82.3
4b8x_A147 SCO5413, possible MARR-transcriptional regulator; 81.82
2fbk_A181 Transcriptional regulator, MARR family; winged-hel 81.18
3l9f_A204 Putative uncharacterized protein SMU.1604C; PADR, 80.23
>2xzm_7 Plectin/S10 domain containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_7 Back     alignment and structure
Probab=100.00  E-value=5.9e-68  Score=430.22  Aligned_cols=122  Identities=34%  Similarity=0.582  Sum_probs=97.4

Q ss_pred             Cc-cchhhHHHHHHHhhhcccEEEeecCCCCCCCccc-cCCHHHHHHhhhcccccccceeeeceeeeeeechhhHHHHHH
Q 030302            1 MI-IPEKNRKEICKYLFQEGVCYAKKDYNLAKHPEID-VPNLQVIKLMQSFKSREYVRETFAWMHYYWYLTNDGIEFLRT   78 (179)
Q Consensus         1 Ml-ipK~nr~~IYe~LFkEGV~VakKD~~~p~Hpel~-VpNL~ViK~mqSLkSrGyVkEqFaWrh~Yw~LTneGI~YLR~   78 (179)
                      || |||+||++||++||||||||||||++  +||||+ ||||||||+||||+|||||||||||||||||||||||+|||+
T Consensus         1 Ml~ipK~nR~~IYe~LFkeGV~VaKKD~~--kHpel~~vpNL~ViKamqSLkSRGyVkEqFaWrhyYw~LTnEGIeYLR~   78 (162)
T 2xzm_7            1 MVHVLKATKIRIYKQLLQDGVFVLKKDFE--GHHEETGVPNLHCYILVRSLKDRGFLEEIFNWGFTYYYLNKEGCEYLKT   78 (162)
T ss_dssp             -CCCCHHHHHHHHHHHHHHTEEEEESCSS--SBCTTTCCBHHHHHHHHHHHHHHTSEEEEEETTEEEEEECHHHHHHHHH
T ss_pred             CCccchHHHHHHHHHHhhcCcEEEecccc--CCCcccCcCcHHHHHHHhcccccccccceeeeEEEEEEEchHHHHHHHH
Confidence            99 99999999999999999999999999  999997 999999999999999999999999999999999999999999


Q ss_pred             hhCCCCC-CccccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccCCC
Q 030302           79 YLNLPSE-IVPATLKKSAKPAGRPMGGPGGDRPRGPPRFDGDRPRFGDREGYRGG  132 (179)
Q Consensus        79 yLhLP~e-iVPaTlk~~~~~~~rp~~~~~g~r~~~~~r~~~~~~~~~dR~~YRr~  132 (179)
                      |||||+| |||+||+++.+++.||+++   +++.+.++     ...+||++|||+
T Consensus        79 yLhLP~e~IVPaTlk~~~~~~~rp~~~---~~~~r~~r-----~~~~dR~~YRr~  125 (162)
T 2xzm_7           79 KLGISADNVIPKTFKASNVNFISKEED---EEERPRRQ-----FNKGGRTGERDG  125 (162)
T ss_dssp             HHCSSTTSCCCGGGSCCCCCCCCCCCC----------------------------
T ss_pred             HhCCCccccccchhccccCCCCCCCCC---CCCCCCCC-----CCCCChhhhhcc
Confidence            9999999 9999999998887777542   11111111     112689999985
>3u5c_K 40S ribosomal protein S10-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_K Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 Back     alignment and structure
>2hgc_A YJCQ protein; SR346, structure, autostructure, NESG, PSI-2, northeast structural genomics consortium, protein structure initiative; NMR {Bacillus subtilis} SCOP: a.4.5.77 Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>3df8_A Possible HXLR family transcriptional factor; APC89000, structural genomics, midwest center for structural genomics, MCSG; 1.65A {Thermoplasma volcanium} SCOP: a.4.5.0 Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>2esh_A Conserved hypothetical protein TM0937; APC5794, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.4.5.61 Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>3l7w_A Putative uncharacterized protein SMU.1704; PADR, transcriptional factor, transcription; HET: MSE; 2.20A {Streptococcus mutans} SCOP: a.4.5.0 Back     alignment and structure
>1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>3f8b_A Transcriptional regulator, PADR-like family; winged helix turn helix, transcription regulator; 2.00A {Lactococcus lactis subsp} SCOP: a.4.5.0 PDB: 3f8c_A* 3f8f_A* Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>1xma_A Predicted transcriptional regulator; southea collaboratory for structural genomics, secsg, protein struc initiative, PSI; 2.30A {Clostridium thermocellum} SCOP: a.4.5.61 Back     alignment and structure
>2dql_A PEX protein; circadian clock associated protein, circadian clock protein; 1.70A {Anabaena SP} Back     alignment and structure
>3elk_A Putative transcriptional regulator TA0346; structural genomics, PSI-2, prote structure initiative; 1.70A {Thermoplasma acidophilum} Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2co5_A Viral protein F93; viral protein-winged helix complex, winged helix, DNA-bindin WHTH, disulfide bond, STIV; 2.2A {Sulfolobus turreted icosahedral virus} SCOP: a.4.5.48 Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>1yg2_A Gene activator APHA; virulence factor, winged helix, transcripti factor, transcription; 2.20A {Vibrio cholerae} SCOP: a.4.5.61 Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>3hhh_A Transcriptional regulator, PADR family; PF03551, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.70A {Enterococcus faecalis} SCOP: a.4.5.0 Back     alignment and structure
>4esf_A PADR-like transcriptional regulator; PADR family, DNA binding protein, HTH fold; 2.20A {Bacillus cereus} Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>3u1d_A Uncharacterized protein; GNTR-superfamily, structural genomics, PSI-biology, midwest for structural genomics, MCSG; 1.80A {Halomicrobium mukohataei} Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>4esb_A Transcriptional regulator, PADR family; DNA binding protein, HTH fold; 2.50A {Bacillus cereus} Back     alignment and structure
>3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 Back     alignment and structure
>2e1n_A PEX, period extender; circadian clock, DNA binding protein, circadian clock protei; 1.80A {Synechococcus elongatus pcc 7942} Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>3aaf_A Werner syndrome ATP-dependent helicase; helix-turn-helix, winged-helix, protein-DNA complex, DNA-BIN helicase; HET: DNA; 1.90A {Homo sapiens} PDB: 2axl_A Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} Back     alignment and structure
>2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 Back     alignment and structure
>3l9f_A Putative uncharacterized protein SMU.1604C; PADR, transcription regulator; 1.80A {Streptococcus mutans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query179
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 96.52
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 95.99
d2esha1114 Hypothetical protein TM0937 {Thermotoga maritima [ 92.22
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 91.44
d1u2wa1108 Cadmium efflux system accessory protein CadC {Stap 90.78
d1xmaa_103 Predicted transcriptional regulator {Clostridium t 90.1
d1r7ja_90 Sso10a (SSO10449) {Archaeon Sulfolobus solfataricu 89.52
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 89.03
d2fbia1136 Probable transcriptional regulator PA4135 {Pseudom 89.01
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 86.73
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 86.26
d2frha1115 Pleiotropic regulator of virulence genes, SarA {St 85.93
d3deua1140 Transcriptional regulator SlyA {Salmonella typhimu 85.32
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 85.3
d2bv6a1136 Transcriptional regulator MgrA {Staphylococcus aur 83.02
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 81.68
d1jgsa_138 Multiple antibiotic resistance repressor, MarR {Es 80.12
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: MarR-like transcriptional regulators
domain: Ta1064 (RFK), N-terminal domain
species: Thermoplasma acidophilum [TaxId: 2303]

Probab=96.52  E-value=0.00099  Score=45.73  Aligned_cols=45  Identities=13%  Similarity=0.273  Sum_probs=42.2

Q ss_pred             ccCCHHHHHHhhhcccccccceeeeceeeeeeechhhHHHHHHhh
Q 030302           36 DVPNLQVIKLMQSFKSREYVRETFAWMHYYWYLTNDGIEFLRTYL   80 (179)
Q Consensus        36 ~VpNL~ViK~mqSLkSrGyVkEqFaWrh~Yw~LTneGI~YLR~yL   80 (179)
                      .+.+=.|.++++.|..+|||+-..-.|..|+.||++|.++|++.+
T Consensus        32 ~i~~~~vs~~l~~Le~~GlV~r~~D~R~~~i~LT~~G~~~l~~~~   76 (85)
T d3ctaa1          32 GISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLDVLYTEF   76 (85)
T ss_dssp             TSCHHHHHHHHHHHHHTTSEEEEEETTEEEEEECHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHCCCeeeecccccccceECHHHHHHHHHHH
Confidence            588889999999999999999999999999999999999999865
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2esha1 a.4.5.61 (A:4-117) Hypothetical protein TM0937 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xmaa_ a.4.5.61 (A:) Predicted transcriptional regulator {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure