Citrus Sinensis ID: 030310


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEVIC
ccccHHHHHcccccccccccccccccccccccccEEEcccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHccccccccccccccccccccccccEEEEEcccccccccccccccEEEEcccccccccEEEEEECcccccccccccHHHHHHHHHHHHccccccccccccccc
*ASTQCFLHH************************IVC**************VSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPT****ITDYGSPEEFLSKVDYLLGKQAYSGKTSSEVIC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTQCFLHHHALSTTPARTSSSQRHVSNIKPTQIVCRAQKQAVQEDDGSAVSRRLALTVLIGAAAVGSKVSPADAAYGESANVFGKPKTNTDFLPYNGDGFKLSIPSKWNPSKEREFPGQVLRYEDNFDSNSNVSVIITPTDKKSITDYGSPEEFLSKVDYLLGKQAYSGKTSSEVIC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Oxygen-evolving enhancer protein 2-1, chloroplastic May be involved in the regulation of photosystem II.probableQ42029
Oxygen-evolving enhancer protein 2, chloroplastic May be involved in the regulation of photosystem II.probableP93566
Oxygen-evolving enhancer protein 2, chloroplastic May be involved in the regulation of photosystem II.probableP12302

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V2B, chain A
Confidence level:very confident
Coverage over the Query: 92-164
View the alignment between query and template
View the model in PyMOL
Template: 2VU4, chain A
Confidence level:very confident
Coverage over the Query: 92-165
View the alignment between query and template
View the model in PyMOL