Citrus Sinensis ID: 030318
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 179 | ||||||
| 225460141 | 226 | PREDICTED: uncharacterized protein LOC10 | 0.849 | 0.672 | 0.494 | 2e-30 | |
| 147794044 | 203 | hypothetical protein VITISV_035107 [Viti | 0.849 | 0.748 | 0.488 | 2e-30 | |
| 255574237 | 218 | protein transporter, putative [Ricinus c | 0.659 | 0.541 | 0.552 | 3e-28 | |
| 449450034 | 218 | PREDICTED: uncharacterized protein LOC10 | 0.709 | 0.582 | 0.592 | 4e-27 | |
| 449483825 | 218 | PREDICTED: uncharacterized LOC101216887 | 0.709 | 0.582 | 0.592 | 5e-27 | |
| 224146286 | 164 | predicted protein [Populus trichocarpa] | 0.553 | 0.603 | 0.594 | 2e-25 | |
| 356495768 | 221 | PREDICTED: uncharacterized protein LOC10 | 0.625 | 0.506 | 0.5 | 8e-23 | |
| 226509360 | 225 | uncharacterized protein LOC100273387 [Ze | 0.435 | 0.346 | 0.653 | 1e-22 | |
| 356539020 | 227 | PREDICTED: uncharacterized protein LOC10 | 0.452 | 0.356 | 0.617 | 2e-22 | |
| 294461593 | 233 | unknown [Picea sitchensis] | 0.435 | 0.334 | 0.628 | 3e-22 |
| >gi|225460141|ref|XP_002275923.1| PREDICTED: uncharacterized protein LOC100243104 isoform 1 [Vitis vinifera] gi|359495234|ref|XP_003634940.1| PREDICTED: uncharacterized protein LOC100243104 isoform 2 [Vitis vinifera] gi|297741015|emb|CBI31327.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 137 bits (345), Expect = 2e-30, Method: Compositional matrix adjust.
Identities = 84/170 (49%), Positives = 108/170 (63%), Gaps = 18/170 (10%)
Query: 5 SSISSSSLRTSPSSLLPCLNQTTFSYSNSTISSHFISTPTTRKRLAPLSKLRISSSENNR 64
S +++S+ PS L P L ++I++HF T++R + LR+SSS N
Sbjct: 2 SLLTNSTTLLRPSKLSPPL----LHPHTASIATHF-----TQRRSRRCNLLRVSSSPQNP 52
Query: 65 TAVDVASPLPTTSNVDGD-DGG-------GAVVVRRFYAGINGRDLASVEELIADDCVYE 116
TA +A P+ TT + + + DGG G+ VVR FYAGIN DL SVEELIA +CVYE
Sbjct: 53 TAT-IAEPVTTTQSDEANGDGGDESILLSGSSVVRAFYAGINSHDLDSVEELIAHNCVYE 111
Query: 117 DLIFPRPFLGRKATLDFFKKFSDSISSDLQFVIDDISAEDSSANGKESHF 166
DLIFP+PF+GRKA +DFF KF D+IS +LQFVIDDIS DSSA G H
Sbjct: 112 DLIFPQPFVGRKAIMDFFNKFIDTISMELQFVIDDISEADSSAVGVTWHL 161
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147794044|emb|CAN71166.1| hypothetical protein VITISV_035107 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255574237|ref|XP_002528033.1| protein transporter, putative [Ricinus communis] gi|223532563|gb|EEF34351.1| protein transporter, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449450034|ref|XP_004142769.1| PREDICTED: uncharacterized protein LOC101216887 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449483825|ref|XP_004156703.1| PREDICTED: uncharacterized LOC101216887 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224146286|ref|XP_002325950.1| predicted protein [Populus trichocarpa] gi|222862825|gb|EEF00332.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356495768|ref|XP_003516745.1| PREDICTED: uncharacterized protein LOC100802494 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|226509360|ref|NP_001141296.1| uncharacterized protein LOC100273387 [Zea mays] gi|194703844|gb|ACF86006.1| unknown [Zea mays] gi|414876798|tpg|DAA53929.1| TPA: hypothetical protein ZEAMMB73_536788 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|356539020|ref|XP_003537998.1| PREDICTED: uncharacterized protein LOC100813246 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|294461593|gb|ADE76357.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 179 | ||||||
| TAIR|locus:2825304 | 216 | AT1G71480 [Arabidopsis thalian | 0.407 | 0.337 | 0.575 | 2.3e-16 |
| TAIR|locus:2825304 AT1G71480 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 203 (76.5 bits), Expect = 2.3e-16, P = 2.3e-16
Identities = 42/73 (57%), Positives = 47/73 (64%)
Query: 93 FYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLXXXXXXXXXXXXXLQFVIDDI 152
FYA +N DL+SV +LIA DCVYEDL+F PF+GRKA L LQFVIDDI
Sbjct: 78 FYAAVNVHDLSSVTDLIAQDCVYEDLVFSSPFVGRKAILDFFGKFIESTSTDLQFVIDDI 137
Query: 153 SAEDSSANGKESH 165
S EDSSA G H
Sbjct: 138 STEDSSAVGVSWH 150
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.318 0.130 0.372 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 179 133 0.00091 102 3 11 22 0.40 31
30 0.43 33
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 567 (60 KB)
Total size of DFA: 119 KB (2077 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 12.17u 0.18s 12.35t Elapsed: 00:00:00
Total cpu time: 12.17u 0.18s 12.35t Elapsed: 00:00:00
Start: Fri May 10 19:28:50 2013 End: Fri May 10 19:28:50 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 179 | |||
| pfam12680 | 101 | pfam12680, SnoaL_2, SnoaL-like domain | 1e-11 | |
| pfam07366 | 126 | pfam07366, SnoaL, SnoaL-like polyketide cyclase | 4e-08 | |
| pfam02136 | 116 | pfam02136, NTF2, Nuclear transport factor 2 (NTF2) | 7e-07 | |
| TIGR02096 | 129 | TIGR02096, TIGR02096, conserved hypothetical prote | 2e-06 | |
| cd00781 | 122 | cd00781, ketosteroid_isomerase, ketosteroid isomer | 0.003 |
| >gnl|CDD|221707 pfam12680, SnoaL_2, SnoaL-like domain | Back alignment and domain information |
|---|
Score = 58.0 bits (141), Expect = 1e-11
Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 3/67 (4%)
Query: 90 VRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLDFFKKFSDSISSDLQFVI 149
VRRFY +N DL ++ EL+A D V+ D P GR+A F + DL+F I
Sbjct: 1 VRRFYEALNAGDLDALAELLAPDVVFHDP--GGPLRGREALRAFLAALFAAF-PDLRFEI 57
Query: 150 DDISAED 156
+ + A+
Sbjct: 58 ERVIADG 64
|
This family contains a large number of proteins that share the SnoaL fold. Length = 101 |
| >gnl|CDD|219387 pfam07366, SnoaL, SnoaL-like polyketide cyclase | Back alignment and domain information |
|---|
| >gnl|CDD|216894 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) domain | Back alignment and domain information |
|---|
| >gnl|CDD|233725 TIGR02096, TIGR02096, conserved hypothetical protein, steroid delta-isomerase-related | Back alignment and domain information |
|---|
| >gnl|CDD|238404 cd00781, ketosteroid_isomerase, ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| cd00781 | 122 | ketosteroid_isomerase ketosteroid isomerase: Many | 99.4 | |
| TIGR02096 | 129 | conserved hypothetical protein, steroid delta-isom | 99.4 | |
| PF12680 | 102 | SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 | 99.35 | |
| PF07366 | 126 | SnoaL: SnoaL-like polyketide cyclase; InterPro: IP | 99.25 | |
| PRK08241 | 339 | RNA polymerase factor sigma-70; Validated | 99.01 | |
| PF07858 | 125 | LEH: Limonene-1,2-epoxide hydrolase catalytic doma | 98.91 | |
| TIGR02246 | 128 | conserved hypothetical protein. This family consis | 98.87 | |
| TIGR02960 | 324 | SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa | 98.86 | |
| PF13474 | 121 | SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE | 98.68 | |
| PRK09636 | 293 | RNA polymerase sigma factor SigJ; Provisional | 98.61 | |
| COG4319 | 137 | Ketosteroid isomerase homolog [Function unknown] | 98.44 | |
| PF14534 | 107 | DUF4440: Domain of unknown function (DUF4440); PDB | 98.39 | |
| cd00531 | 124 | NTF2_like Nuclear transport factor 2 (NTF2-like) s | 98.35 | |
| TIGR02957 | 281 | SigX4 RNA polymerase sigma-70 factor, TIGR02957 fa | 98.24 | |
| COG3631 | 133 | Ketosteroid isomerase-related protein [General fun | 98.07 | |
| PF13577 | 127 | SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RF | 98.05 | |
| PRK09635 | 290 | sigI RNA polymerase sigma factor SigI; Provisional | 97.72 | |
| PF02136 | 118 | NTF2: Nuclear transport factor 2 (NTF2) domain; In | 97.58 | |
| COG4922 | 129 | Uncharacterized protein conserved in bacteria [Fun | 97.56 | |
| PF10184 | 113 | DUF2358: Uncharacterized conserved protein (DUF235 | 97.56 | |
| COG4308 | 130 | LimA Limonene-1,2-epoxide hydrolase [Secondary met | 97.35 | |
| PF07080 | 143 | DUF1348: Protein of unknown function (DUF1348); In | 97.28 | |
| PF08332 | 128 | CaMKII_AD: Calcium/calmodulin dependent protein ki | 97.22 | |
| COG5485 | 131 | Predicted ester cyclase [General function predicti | 97.1 | |
| COG4538 | 112 | Uncharacterized conserved protein [Function unknow | 96.8 | |
| PF09150 | 159 | Carot_N: Orange carotenoid protein, N-terminal ; I | 96.47 | |
| cd00667 | 160 | ring_hydroxylating_dioxygenases_beta Ring hydroxyl | 96.44 | |
| PF12893 | 116 | Lumazine_bd_2: Putative lumazine-binding; PDB: 3BL | 96.08 | |
| cd00780 | 119 | NTF2 Nuclear transport factor 2 (NTF2) domain play | 95.96 | |
| PF05223 | 118 | MecA_N: NTF2-like N-terminal transpeptidase domain | 95.72 | |
| PF11533 | 125 | DUF3225: Protein of unknown function (DUF3225); In | 95.52 | |
| COG4875 | 156 | Uncharacterized protein conserved in bacteria with | 94.89 | |
| PF12870 | 111 | Lumazine_bd: Lumazine-binding domain; InterPro: IP | 94.77 | |
| PRK10069 | 183 | 3-phenylpropionate dioxygenase subunit beta; Provi | 93.39 | |
| COG3558 | 154 | Uncharacterized protein conserved in bacteria [Fun | 92.8 | |
| PF03284 | 162 | PHZA_PHZB: Phenazine biosynthesis protein A/B; Int | 90.35 | |
| KOG4457 | 202 | consensus Uncharacterized conserved protein [Funct | 82.18 | |
| TIGR03231 | 155 | anthran_1_2_B anthranilate 1,2-dioxygenase, small | 80.94 |
| >cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon | Back alignment and domain information |
|---|
Probab=99.40 E-value=2.6e-12 Score=95.25 Aligned_cols=88 Identities=22% Similarity=0.212 Sum_probs=69.6
Q ss_pred CcHHHHHHHHHHHHhCCCHHHHHhhhccCceEeeCCCCCCccCHHHHHHHHHHHHHhcCCCeEEEEEe-eecCCCceEEE
Q 030318 84 GGGAVVVRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLDFFKKFSDSISSDLQFVIDD-ISAEDSSANGK 162 (179)
Q Consensus 84 ~~~~~vVrrfyeA~Na~D~dal~eLfApD~v~~dp~~~~Pi~Greav~~ff~~~~~afp~dl~~~I~e-v~egD~~aV~v 162 (179)
...++++++|+++||++|++.+.+||+||++|++|..+.|++|++++++++..+.+..+ ++++.+.. +..|+..++.+
T Consensus 3 ~~~~~~v~~~~~a~~~~D~~~~~~l~aed~~~~~p~~~~~~~G~~~i~~~~~~~~~~~~-~~~~~~~~~~~~g~~~~~~~ 81 (122)
T cd00781 3 QEMKAAVQRYVEAVNAGDPEGIVALFADDATVEDPVGSPPRSGRAAIAAFYAQSLGGAK-RLELTGPVRASHGGEAAFAF 81 (122)
T ss_pred HHHHHHHHHHHHHHHCCCHHHHHHHcCCCeEEeCCCCCCCccCHHHHHHHHHHHhccCc-eEEecCceeeecCCEEEEEE
Confidence 34788999999999999999999999999999998766689999999999999987754 56665544 34566445555
Q ss_pred EEEEEeCCce
Q 030318 163 ESHFLSAKVA 172 (179)
Q Consensus 163 ~w~lew~~~~ 172 (179)
+|+...++..
T Consensus 82 ~~~~~~~g~~ 91 (122)
T cd00781 82 RVEFEWEGQP 91 (122)
T ss_pred EEEEEeCCce
Confidence 6666666543
|
Ketosteroid isomerases are important members of this class of enzymes which are the most proficient of all enzymes known and have served as a paradigm for enzymatic enolizations since its discovery in 1954. This CD includes members of this class that calalyze the isomerization of various beta,gamma-unsaturated isomers at nearly a diffusion-controlled rate. These enzymes are widely distributed in bacteria. |
| >TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related | Back alignment and domain information |
|---|
| >PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A | Back alignment and domain information |
|---|
| >PF07366 SnoaL: SnoaL-like polyketide cyclase; InterPro: IPR009959 This domain is found in SnoaL [] a polyketide cyclase involved in nogalamycin biosynthesis | Back alignment and domain information |
|---|
| >PRK08241 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PF07858 LEH: Limonene-1,2-epoxide hydrolase catalytic domain; InterPro: IPR013100 Epoxide hydrolases catalyse the hydrolysis of epoxides to corresponding diols, which is important in detoxification, synthesis of signal molecules, or metabolism | Back alignment and domain information |
|---|
| >TIGR02246 conserved hypothetical protein | Back alignment and domain information |
|---|
| >TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family | Back alignment and domain information |
|---|
| >PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B | Back alignment and domain information |
|---|
| >PRK09636 RNA polymerase sigma factor SigJ; Provisional | Back alignment and domain information |
|---|
| >COG4319 Ketosteroid isomerase homolog [Function unknown] | Back alignment and domain information |
|---|
| >PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A | Back alignment and domain information |
|---|
| >cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily | Back alignment and domain information |
|---|
| >TIGR02957 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family | Back alignment and domain information |
|---|
| >COG3631 Ketosteroid isomerase-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13577 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RFR_A 3B8L_F 2CHC_A 3A76_A 3EF8_B | Back alignment and domain information |
|---|
| >PRK09635 sigI RNA polymerase sigma factor SigI; Provisional | Back alignment and domain information |
|---|
| >PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein | Back alignment and domain information |
|---|
| >COG4922 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF10184 DUF2358: Uncharacterized conserved protein (DUF2358); InterPro: IPR018790 This entry represents a family of conserved proteins | Back alignment and domain information |
|---|
| >COG4308 LimA Limonene-1,2-epoxide hydrolase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF07080 DUF1348: Protein of unknown function (DUF1348); InterPro: IPR009783 This family consists of several highly conserved hypothetical proteins of around 150 residues in length | Back alignment and domain information |
|---|
| >PF08332 CaMKII_AD: Calcium/calmodulin dependent protein kinase II Association; InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >COG5485 Predicted ester cyclase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4538 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09150 Carot_N: Orange carotenoid protein, N-terminal ; InterPro: IPR015233 Carotenoids such as beta-carotene, lycopene, lutein and beta-cryptoxanthine are produced in plants and certain bacteria, algae and fungi, where they function as accessory photosynthetic pigments and as scavengers of oxygen radicals for photoprotection | Back alignment and domain information |
|---|
| >cd00667 ring_hydroxylating_dioxygenases_beta Ring hydroxylating dioxygenase beta subunit | Back alignment and domain information |
|---|
| >PF12893 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BLZ_C 3DUK_F 3FKA_C | Back alignment and domain information |
|---|
| >cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus | Back alignment and domain information |
|---|
| >PF05223 MecA_N: NTF2-like N-terminal transpeptidase domain; InterPro: IPR007887 The multiple antibiotic resistance of methicillin-resistant strains of Staphylococcus aureus (MRSA) has become a major clinical problem worldwide | Back alignment and domain information |
|---|
| >PF11533 DUF3225: Protein of unknown function (DUF3225); InterPro: IPR024507 This family of proteins has no known function | Back alignment and domain information |
|---|
| >COG4875 Uncharacterized protein conserved in bacteria with a cystatin-like fold [Function unknown] | Back alignment and domain information |
|---|
| >PF12870 Lumazine_bd: Lumazine-binding domain; InterPro: IPR024267 This entry represents a lumazine-binding domain found in a family of putative lipoproteins from bacteria | Back alignment and domain information |
|---|
| >PRK10069 3-phenylpropionate dioxygenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >COG3558 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF03284 PHZA_PHZB: Phenazine biosynthesis protein A/B; InterPro: IPR004964 The phenazine biosynthesis proteins A and B are involved in the biosynthesis of this antibiotic | Back alignment and domain information |
|---|
| >KOG4457 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03231 anthran_1_2_B anthranilate 1,2-dioxygenase, small subunit | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 179 | |||
| 3fh1_A | 129 | Uncharacterized NTF2-like protein; structural geno | 1e-13 | |
| 3k0z_A | 159 | Putative polyketide cyclase; structural genomics, | 1e-11 | |
| 1oh0_A | 131 | Steroid delta-isomerase; ketosteroid isomerase, KS | 6e-11 | |
| 2gey_A | 158 | ACLR protein; alpha+beta barrel, oxidoreductase; H | 6e-10 | |
| 2gex_A | 152 | SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St | 2e-09 | |
| 2f99_A | 153 | Aklanonic acid methyl ester cyclase, AKNH; anthrac | 3e-09 | |
| 3i0y_A | 140 | Putative polyketide cyclase; cystatin-like fold, s | 9e-09 | |
| 2bng_A | 149 | MB2760; epoxide hydrolase, limonene, hydrolase, st | 2e-08 | |
| 1nww_A | 149 | Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R | 2e-08 | |
| 1ohp_A | 125 | Steroid delta-isomerase; inhibitor; HET: ESR; 1.53 | 2e-08 | |
| 3f9s_A | 146 | Putative polyketide cyclase; structural genomics, | 8e-08 | |
| 3rga_A | 283 | Epoxide hydrolase; NTF2-like, epoxide-opening cycl | 1e-07 | |
| 1tuh_A | 156 | BAL32A, hypothetical protein EGC068; unknown funct | 1e-07 | |
| 1s5a_A | 150 | Hypothetical protein YESE; structural genomics, PS | 2e-07 | |
| 3mso_A | 143 | Steroid delta-isomerase; structural genomics, join | 2e-07 | |
| 1z1s_A | 163 | Hypothetical protein PA3332; beta barrel, conserve | 3e-07 | |
| 3fgy_A | 135 | Uncharacterized NTF2-like protein; structural geno | 3e-07 | |
| 3g8z_A | 148 | Protein of unknown function with cystatin-like FO; | 3e-07 | |
| 1sjw_A | 144 | Nogalonic acid methyl ester cyclase; anthracycline | 4e-07 | |
| 3f8h_A | 150 | Putative polyketide cyclase; structural genomics, | 4e-07 | |
| 3ebt_A | 132 | Uncharacterized NTF2-like protein; structural geno | 2e-06 | |
| 3f7s_A | 142 | Uncharacterized NTF2-like protein; structural geno | 3e-06 | |
| 3ec9_A | 140 | Uncharacterized NTF2-like protein; structural geno | 5e-06 | |
| 3ehc_A | 128 | Snoal-like polyketide cyclase; structural genomics | 5e-06 | |
| 3dm8_A | 143 | Uncharacterized protein RPA4348; siras, putative i | 5e-06 | |
| 3f7x_A | 151 | Putative polyketide cyclase; structural genomics, | 8e-06 | |
| 3hx8_A | 129 | MLR2180 protein, putative ketosteroid isomerase; s | 2e-05 | |
| 3rob_A | 139 | Uncharacterized conserved protein; structural geno | 4e-05 | |
| 3grd_A | 134 | Uncharacterized NTF2-superfamily protein; NP_97724 | 4e-05 | |
| 2a15_A | 139 | Hypothetical protein RV0760C; beta-alpha-barrel, s | 7e-05 | |
| 3g16_A | 156 | Uncharacterized protein with cystatin-like fold; Y | 9e-05 | |
| 3d9r_A | 135 | Ketosteroid isomerase-like protein; YP_049581.1, s | 1e-04 | |
| 3mg1_A | 323 | OCP, orange carotenoid protein; carotenoid binding | 4e-04 | |
| 3f8x_A | 148 | Putative delta-5-3-ketosteroid isomerase; structur | 4e-04 |
| >3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} Length = 129 | Back alignment and structure |
|---|
Score = 63.5 bits (154), Expect = 1e-13
Identities = 17/74 (22%), Positives = 33/74 (44%), Gaps = 5/74 (6%)
Query: 89 VVRRFYAGINGRDLASVEELIADDCVYEDLI---FPRPFLGRKATLDFFKKFSDSISSDL 145
++RRF D A++ ELIA++CV E+ + GR+A + + +
Sbjct: 22 IMRRFNDVFQLHDPAALPELIAEECVIENTVPAPDGARHAGRQACVQLWSAIAT--QPGT 79
Query: 146 QFVIDDISAEDSSA 159
+F +++ A
Sbjct: 80 RFDLEETFVAGDRA 93
|
| >3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} Length = 159 | Back alignment and structure |
|---|
| >1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... Length = 131 | Back alignment and structure |
|---|
| >2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9 Length = 158 | Back alignment and structure |
|---|
| >2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 Length = 152 | Back alignment and structure |
|---|
| >2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A* Length = 153 | Back alignment and structure |
|---|
| >3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} Length = 140 | Back alignment and structure |
|---|
| >2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 Length = 149 | Back alignment and structure |
|---|
| >1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* Length = 149 | Back alignment and structure |
|---|
| >1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A Length = 125 | Back alignment and structure |
|---|
| >3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23} Length = 146 | Back alignment and structure |
|---|
| >3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Length = 283 | Back alignment and structure |
|---|
| >1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 Length = 156 | Back alignment and structure |
|---|
| >1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 Length = 150 | Back alignment and structure |
|---|
| >3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa} Length = 143 | Back alignment and structure |
|---|
| >1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10 Length = 163 | Back alignment and structure |
|---|
| >3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} Length = 135 | Back alignment and structure |
|---|
| >3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} Length = 148 | Back alignment and structure |
|---|
| >1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9 Length = 144 | Back alignment and structure |
|---|
| >3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP} Length = 150 | Back alignment and structure |
|---|
| >3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 Length = 132 | Back alignment and structure |
|---|
| >3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} Length = 142 | Back alignment and structure |
|---|
| >3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 Length = 140 | Back alignment and structure |
|---|
| >3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str} Length = 128 | Back alignment and structure |
|---|
| >3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 Length = 143 | Back alignment and structure |
|---|
| >3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440} Length = 151 | Back alignment and structure |
|---|
| >3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} Length = 129 | Back alignment and structure |
|---|
| >3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} Length = 139 | Back alignment and structure |
|---|
| >3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} Length = 134 | Back alignment and structure |
|---|
| >2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A Length = 139 | Back alignment and structure |
|---|
| >3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} Length = 156 | Back alignment and structure |
|---|
| >3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 Length = 135 | Back alignment and structure |
|---|
| >3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A* Length = 323 | Back alignment and structure |
|---|
| >3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043} Length = 148 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| 3mg1_A | 323 | OCP, orange carotenoid protein; carotenoid binding | 99.89 | |
| 4h3u_A | 158 | Hypothetical protein; structural genomics, PSI-bio | 99.65 | |
| 3ff2_A | 117 | Uncharacterized cystatin fold protein (YP_497570. | 99.59 | |
| 3fh1_A | 129 | Uncharacterized NTF2-like protein; structural geno | 99.51 | |
| 3f9s_A | 146 | Putative polyketide cyclase; structural genomics, | 99.49 | |
| 3ebt_A | 132 | Uncharacterized NTF2-like protein; structural geno | 99.49 | |
| 3k0z_A | 159 | Putative polyketide cyclase; structural genomics, | 99.49 | |
| 3kkg_A | 146 | Putative snoal-like polyketide cyclase; structural | 99.47 | |
| 2gex_A | 152 | SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St | 99.46 | |
| 2k54_A | 123 | Protein ATU0742; protein of unknown function, stru | 99.45 | |
| 2f99_A | 153 | Aklanonic acid methyl ester cyclase, AKNH; anthrac | 99.45 | |
| 3h3h_A | 122 | Uncharacterized snoal-like protein; structural gen | 99.44 | |
| 1sjw_A | 144 | Nogalonic acid methyl ester cyclase; anthracycline | 99.44 | |
| 3ec9_A | 140 | Uncharacterized NTF2-like protein; structural geno | 99.43 | |
| 3g8z_A | 148 | Protein of unknown function with cystatin-like FO; | 99.43 | |
| 3g16_A | 156 | Uncharacterized protein with cystatin-like fold; Y | 99.42 | |
| 3ehc_A | 128 | Snoal-like polyketide cyclase; structural genomics | 99.41 | |
| 2a15_A | 139 | Hypothetical protein RV0760C; beta-alpha-barrel, s | 99.41 | |
| 3dm8_A | 143 | Uncharacterized protein RPA4348; siras, putative i | 99.41 | |
| 3f14_A | 112 | Uncharacterized NTF2-like protein; YP_680363.1, NT | 99.41 | |
| 3fgy_A | 135 | Uncharacterized NTF2-like protein; structural geno | 99.4 | |
| 1oh0_A | 131 | Steroid delta-isomerase; ketosteroid isomerase, KS | 99.4 | |
| 2gey_A | 158 | ACLR protein; alpha+beta barrel, oxidoreductase; H | 99.37 | |
| 1ohp_A | 125 | Steroid delta-isomerase; inhibitor; HET: ESR; 1.53 | 99.36 | |
| 1nww_A | 149 | Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R | 99.34 | |
| 3grd_A | 134 | Uncharacterized NTF2-superfamily protein; NP_97724 | 99.34 | |
| 3g0k_A | 148 | Putative membrane protein; snoal-like polyketide c | 99.33 | |
| 3mso_A | 143 | Steroid delta-isomerase; structural genomics, join | 99.33 | |
| 3hk4_A | 136 | MLR7391 protein; NTF2-like protein, structural gen | 99.32 | |
| 3dxo_A | 121 | Uncharacterized snoal-like protein; putative isome | 99.32 | |
| 3i0y_A | 140 | Putative polyketide cyclase; cystatin-like fold, s | 99.31 | |
| 1s5a_A | 150 | Hypothetical protein YESE; structural genomics, PS | 99.29 | |
| 3dmc_A | 134 | NTF2-like protein; structural genomics, joint cent | 99.29 | |
| 3f8h_A | 150 | Putative polyketide cyclase; structural genomics, | 99.27 | |
| 2bng_A | 149 | MB2760; epoxide hydrolase, limonene, hydrolase, st | 99.26 | |
| 3d9r_A | 135 | Ketosteroid isomerase-like protein; YP_049581.1, s | 99.24 | |
| 1tuh_A | 156 | BAL32A, hypothetical protein EGC068; unknown funct | 99.24 | |
| 3f7x_A | 151 | Putative polyketide cyclase; structural genomics, | 99.23 | |
| 3flj_A | 155 | Uncharacterized protein conserved in bacteria WIT | 99.22 | |
| 3rga_A | 283 | Epoxide hydrolase; NTF2-like, epoxide-opening cycl | 99.21 | |
| 3en8_A | 128 | Uncharacterized NTF-2 like protein; YP_553245.1, N | 99.2 | |
| 3er7_A | 131 | Uncharacterized NTF2-like protein; YP_001812677.1, | 99.19 | |
| 1z1s_A | 163 | Hypothetical protein PA3332; beta barrel, conserve | 99.19 | |
| 3f8x_A | 148 | Putative delta-5-3-ketosteroid isomerase; structur | 99.16 | |
| 3hx8_A | 129 | MLR2180 protein, putative ketosteroid isomerase; s | 99.15 | |
| 3rga_A | 283 | Epoxide hydrolase; NTF2-like, epoxide-opening cycl | 99.14 | |
| 3f40_A | 114 | Uncharacterized NTF2-like protein; YP_677363.1, NT | 99.12 | |
| 3lyg_A | 120 | NTF2-like protein of unknown function; structural | 98.98 | |
| 3f7s_A | 142 | Uncharacterized NTF2-like protein; structural geno | 98.96 | |
| 2gxf_A | 142 | Hypothetical protein YYBH; alpha-beta protein., st | 98.96 | |
| 3gwr_A | 144 | Putative calcium/calmodulin-dependent protein KIN | 98.94 | |
| 3h51_A | 156 | Putative calcium/calmodulin dependent protein KIN | 98.89 | |
| 3jum_A | 185 | Phenazine biosynthesis protein A/B; chirality, dru | 98.85 | |
| 3rob_A | 139 | Uncharacterized conserved protein; structural geno | 98.82 | |
| 3ff0_A | 163 | Phenazine biosynthesis protein PHZB 2; cystatin-li | 98.76 | |
| 2ux0_A | 143 | Calcium-calmodulin dependent protein kinase (CAM I | 98.7 | |
| 3cu3_A | 172 | Domain of unknown function with A cystatin-like F; | 98.65 | |
| 4i4k_A | 143 | Uncharacterized protein SGCJ; structural genomics, | 98.62 | |
| 3gzr_A | 146 | Uncharacterized protein with A NTF2-like fold; str | 98.6 | |
| 3bb9_A | 148 | Putative orphan protein; structural genomics, join | 98.45 | |
| 1tp6_A | 128 | Hypothetical protein PA1314; structural genomics, | 98.41 | |
| 2chc_A | 170 | Protein RV3472; hypothetical protein; 1.69A {Mycob | 98.36 | |
| 3b7c_A | 122 | Uncharacterized protein; NTF-2 like protein, struc | 98.33 | |
| 2rgq_A | 144 | Domain of unknown function with A cystatin-like F; | 98.3 | |
| 3cnx_A | 170 | Uncharacterized protein; putative dehydratase, NTF | 98.29 | |
| 3b8l_A | 163 | Uncharacterized protein; putative aromatic ring hy | 98.26 | |
| 3ke7_A | 134 | Putative ketosteroid isomerase; structural genomic | 98.23 | |
| 2rcd_A | 129 | Uncharacterized protein; structural genomics, join | 98.23 | |
| 2rfr_A | 155 | Uncharacterized protein; structural genomics, join | 98.18 | |
| 3a76_A | 176 | Gamma-hexachlorocyclohexane dehydrochlorinase; bar | 98.11 | |
| 3ef8_A | 150 | Putative scyalone dehydratase; YP_496742.1, struct | 98.04 | |
| 3ejv_A | 179 | Uncharacterized protein with cystatin-like fold; s | 97.99 | |
| 2owp_A | 129 | Hypothetical protein BXE_B1374; cystatin-like fold | 97.89 | |
| 3gzb_A | 154 | Putative snoal-like polyketide cyclase; YP_0011826 | 97.59 | |
| 2imj_A | 166 | Hypothetical protein DUF1348; alpha beta protein, | 97.58 | |
| 2r4i_A | 123 | Uncharacterized protein; NTF2-like protein, struct | 97.33 | |
| 4gb5_A | 159 | Uncharacterized protein; structural genomics, PSI- | 97.26 | |
| 2f86_B | 143 | Hypothetical protein K11E8.1D; UNC-43, oligomeriza | 97.24 | |
| 3fsd_A | 134 | NTF2-like protein of unknown function in nutrient; | 97.08 | |
| 3blz_A | 128 | NTF2-like protein of unknown function; structural | 96.93 | |
| 3ecf_A | 130 | NTF2-like protein; structural genomics, joint cent | 96.73 | |
| 3soy_A | 145 | NTF2-like superfamily protein; structural genomics | 96.69 | |
| 3duk_A | 125 | NTF2-like protein of unknown function; structural | 95.89 | |
| 2gbw_B | 174 | Biphenyl 2,3-dioxygenase beta subunit; rieske oxyg | 95.46 | |
| 3eby_A | 163 | Beta subunit of A putative aromatic-ring-hydroxyl | 94.87 | |
| 1uli_B | 187 | Biphenyl dioxygenase small subunit; alpha3 BETA3 h | 94.84 | |
| 2b1x_B | 172 | Naphthalene dioxygenase small subunit; rieske non- | 94.6 | |
| 3fka_A | 120 | Uncharacterized NTF-2 like protein; structural gen | 94.44 | |
| 3ujm_A | 120 | Rasputin; NTF2-like fold, RAS signaling, signaling | 94.25 | |
| 2qiy_A | 154 | UBP3-associated protein BRE5; deubiquitylation, ub | 93.69 | |
| 1wql_B | 186 | Ethylbenzene dioxygenase small subunit; biphenyl d | 93.34 | |
| 3ksp_A | 129 | Calcium/calmodulin-dependent kinase II associatio; | 93.16 | |
| 3e99_A | 164 | Benzoate 1,2-dioxygenase beta subunit; structural | 92.45 | |
| 1zo2_A | 129 | NTF2, nuclear transport factor 2; structural genom | 92.15 | |
| 1idp_A | 172 | Scytalone dehydratase; lyase, melanine biosynthesi | 91.81 | |
| 1gy6_A | 127 | Nuclear transport factor 2; 1.6A {Rattus norvegicu | 90.86 | |
| 3nv0_B | 154 | NTF2-related export protein; NTF2-like domain, bet | 90.55 | |
| 1gy7_A | 125 | Nuclear transport factor 2; protein transport; 1.6 | 89.98 | |
| 1jkg_A | 140 | P15; NTF2-like domain, transport protein; 1.90A {H | 89.34 | |
| 3gzx_B | 186 | Biphenyl dioxygenase subunit beta; rieskie, non-he | 89.12 | |
| 2bmo_B | 194 | Oxygenase-beta NBDO; nitrobenzene dioxygenase, nit | 88.84 | |
| 3q90_A | 140 | RAS GTPase-activating protein-binding protein 1; s | 88.54 | |
| 1vqq_A | 646 | Saupbp2A, penicillin-binding protein MECA, low-aff | 84.3 |
| >3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A* | Back alignment and structure |
|---|
Probab=99.89 E-value=1.4e-24 Score=188.35 Aligned_cols=127 Identities=14% Similarity=0.234 Sum_probs=109.3
Q ss_pred cccCCCCCcEEEecccccccccc-------ccCC-CCCCCCCCCC----CCcHHHHHHHHHHHHhCCCHHHHHhhhccCc
Q 030318 46 RKRLAPLSKLRISSSENNRTAVD-------VASP-LPTTSNVDGD----DGGGAVVVRRFYAGINGRDLASVEELIADDC 113 (179)
Q Consensus 46 ~~~l~~~qqi~v~~~~~~~~~~~-------v~~p-~~~t~~~~~~----~~~~~~vVrrfyeA~Na~D~dal~eLfApD~ 113 (179)
.|+||.+|||||+||.|++|||| |+|| |+||++++|. .|..+.+|++|++++|++|++++.+||++|+
T Consensus 142 I~~Ldf~QQItvlR~~V~~MG~dp~~~~~~~~~~~~~~~~~~~~~~~~i~gi~~~tVl~Y~e~lNa~Df~a~aaLFA~Dg 221 (323)
T 3mg1_A 142 IQGLESGQQITVLRNAVVDMGFTAGKDGKRIAEPVVPPQDTASRTKVSIEGVTNATVLNYMDNLNANDFDTLIELFTSDG 221 (323)
T ss_dssp HHTSCHHHHHHHHHHHHHTCCC-------CBCCCCCCCCCGGGCCCCCBBTBCCHHHHHHHHHHHTTCHHHHHTTEEEEE
T ss_pred HHcCChhhhHHHHHHHHHHcCCCCCcccccccCCccCCCCcccccccCccCcchHHHHHHHHHhcccCHHHHHHHccCCC
Confidence 39999999999999999999999 8999 9999999983 3888999999999999999999999999999
Q ss_pred eEeeCCCCCCccCHHHHHHHHHHHHHhcCCCeEEEEEeeecCCCceEEEEEEEE--eCCcee
Q 030318 114 VYEDLIFPRPFLGRKATLDFFKKFSDSISSDLQFVIDDISAEDSSANGKESHFL--SAKVAA 173 (179)
Q Consensus 114 v~~dp~~~~Pi~Greav~~ff~~~~~afp~dl~~~I~ev~egD~~aV~v~w~le--w~~~~~ 173 (179)
+.+ |||+.|++|+|+|++||++.++++...++-.+.+..++++.+++++..++ |-++..
T Consensus 222 ~Le-pPf~~PIvGreAI~~y~~~eaq~~~l~P~~g~~ep~e~g~~qi~vtGkVqTpwfGv~v 282 (323)
T 3mg1_A 222 ALQ-PPFQRPIVGKENVLRFFREECQNLKLIPERGVTEPAEDGFTQIKVTGKVQTPWFGGNV 282 (323)
T ss_dssp EEE-CTTSCCEESHHHHHHHHHHHCTTCEEEEEEEEEEECGGGCEEEEEEEEEECTTTGGGC
T ss_pred eeC-CCCCCCccCHHHHHHHHHHHhccCEEeeccCccccccCCCceEEEEEEEEcccCCccc
Confidence 999 68889999999999999999998776777777777666667766655544 444433
|
| >4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila} | Back alignment and structure |
|---|
| >3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23} | Back alignment and structure |
|---|
| >3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 | Back alignment and structure |
|---|
| >3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} | Back alignment and structure |
|---|
| >3kkg_A Putative snoal-like polyketide cyclase; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, lyase; HET: MSE PGE; 1.40A {Jannaschia SP} | Back alignment and structure |
|---|
| >2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 | Back alignment and structure |
|---|
| >2k54_A Protein ATU0742; protein of unknown function, structural genomics, PSI-2, Pro structure initiative; NMR {Agrobacterium tumefaciens str} SCOP: d.17.4.29 | Back alignment and structure |
|---|
| >2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A* | Back alignment and structure |
|---|
| >3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264} | Back alignment and structure |
|---|
| >1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9 | Back alignment and structure |
|---|
| >3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 | Back alignment and structure |
|---|
| >3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} | Back alignment and structure |
|---|
| >3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A | Back alignment and structure |
|---|
| >3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 | Back alignment and structure |
|---|
| >3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0 | Back alignment and structure |
|---|
| >1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... | Back alignment and structure |
|---|
| >2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9 | Back alignment and structure |
|---|
| >1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A | Back alignment and structure |
|---|
| >1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* | Back alignment and structure |
|---|
| >3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} SCOP: d.17.4.0 | Back alignment and structure |
|---|
| >3g0k_A Putative membrane protein; snoal-like polyketide cyclase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.30A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19 | Back alignment and structure |
|---|
| >3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 | Back alignment and structure |
|---|
| >3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10 | Back alignment and structure |
|---|
| >3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP} | Back alignment and structure |
|---|
| >2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 | Back alignment and structure |
|---|
| >3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 | Back alignment and structure |
|---|
| >1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 | Back alignment and structure |
|---|
| >3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3flj_A Uncharacterized protein conserved in bacteria WIT cystatin-like fold; YP_168589.1; HET: MSE; 2.00A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} | Back alignment and structure |
|---|
| >3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20 | Back alignment and structure |
|---|
| >3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24 | Back alignment and structure |
|---|
| >1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10 | Back alignment and structure |
|---|
| >3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} | Back alignment and structure |
|---|
| >3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3lyg_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE GOL; 1.61A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 | Back alignment and structure |
|---|
| >3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} | Back alignment and structure |
|---|
| >3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A* | Back alignment and structure |
|---|
| >3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >3ff0_A Phenazine biosynthesis protein PHZB 2; cystatin-like fold, antibiotic biosynthesis, virulence, STRU genomics; 1.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A* | Back alignment and structure |
|---|
| >3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} | Back alignment and structure |
|---|
| >3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides} | Back alignment and structure |
|---|
| >3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 | Back alignment and structure |
|---|
| >1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12 | Back alignment and structure |
|---|
| >2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25 | Back alignment and structure |
|---|
| >3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16 | Back alignment and structure |
|---|
| >2rgq_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.80A {Nostoc punctiforme} SCOP: d.17.4.25 | Back alignment and structure |
|---|
| >3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17 | Back alignment and structure |
|---|
| >3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >3ke7_A Putative ketosteroid isomerase; structural genomics, joint C structural genomics, JCSG, protein structure initiative; HET: MSE BCN; 1.45A {Parabacteroides distasonis atcc 8503} | Back alignment and structure |
|---|
| >2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18 | Back alignment and structure |
|---|
| >2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >3ef8_A Putative scyalone dehydratase; YP_496742.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE PG4; 1.50A {Novosphingobium aromaticivorans DSM12444} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >3ejv_A Uncharacterized protein with cystatin-like fold; structural genomics, joint center for ST genomics, JCSG; HET: MSE PGE; 1.40A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18 | Back alignment and structure |
|---|
| >3gzb_A Putative snoal-like polyketide cyclase; YP_001182657.1, STRU genomics, joint center for structural genomics, JCSG; HET: MSE; 1.44A {Shewanella putrefaciens} PDB: 3lza_A* | Back alignment and structure |
|---|
| >2imj_A Hypothetical protein DUF1348; alpha beta protein, structural genomics, PSI-2, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} SCOP: d.17.4.23 | Back alignment and structure |
|---|
| >2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15 | Back alignment and structure |
|---|
| >4gb5_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, snoal-like domain, unknown function; HET: PGE; 1.55A {Kribbella flavida} | Back alignment and structure |
|---|
| >2f86_B Hypothetical protein K11E8.1D; UNC-43, oligomerization domain, transferase; 2.64A {Caenorhabditis elegans} SCOP: d.17.4.7 | Back alignment and structure |
|---|
| >3fsd_A NTF2-like protein of unknown function in nutrient; YP_427473.1, NTF2-like protein of unknown function in nutrie uptake; HET: UNL; 1.70A {Rhodospirillum rubrum atcc 11170} SCOP: d.17.4.0 | Back alignment and structure |
|---|
| >3blz_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.75A {Shewanella baltica} SCOP: d.17.4.14 | Back alignment and structure |
|---|
| >3ecf_A NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Anabaena variabilis atcc 29413} SCOP: d.17.4.21 | Back alignment and structure |
|---|
| >3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3duk_A NTF2-like protein of unknown function; structural genomics, joint center for STR genomics, JCSG, protein structure initiative; HET: MSE; 2.20A {Methylobacillus flagellatus KT} SCOP: d.17.4.0 | Back alignment and structure |
|---|
| >2gbw_B Biphenyl 2,3-dioxygenase beta subunit; rieske oxygenase, oxidoreductase, non heme iron; 1.70A {Sphingobium yanoikuyae} PDB: 2gbx_B* 2ckf_B | Back alignment and structure |
|---|
| >3eby_A Beta subunit of A putative aromatic-ring-hydroxyl dioxygenase; YP_001165631.1; 1.75A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} SCOP: d.17.4.4 | Back alignment and structure |
|---|
| >1uli_B Biphenyl dioxygenase small subunit; alpha3 BETA3 hetero hexamer, oxidoreductase; 2.20A {Rhodococcus SP} SCOP: d.17.4.4 PDB: 1ulj_B* 3en1_B* 3eqq_B | Back alignment and structure |
|---|
| >2b1x_B Naphthalene dioxygenase small subunit; rieske non-heme iron oxygenase, oxidoreductase; 2.00A {Rhodococcus SP} SCOP: d.17.4.4 PDB: 2b24_B | Back alignment and structure |
|---|
| >3fka_A Uncharacterized NTF-2 like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.69A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A | Back alignment and structure |
|---|
| >1wql_B Ethylbenzene dioxygenase small subunit; biphenyl dioxygenase, cumene dioxygenase; 2.20A {Pseudomonas fluorescens} SCOP: d.17.4.4 | Back alignment and structure |
|---|
| >3ksp_A Calcium/calmodulin-dependent kinase II associatio; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG; HET: MSE NHE; 2.59A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3e99_A Benzoate 1,2-dioxygenase beta subunit; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Burkholderia mallei atcc 23344} SCOP: d.17.4.4 | Back alignment and structure |
|---|
| >1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 | Back alignment and structure |
|---|
| >1idp_A Scytalone dehydratase; lyase, melanine biosynthesis; 1.45A {Magnaporthe grisea} SCOP: d.17.4.1 PDB: 2std_A* 1std_A* 3std_A* 6std_A* 4std_A* 5std_A* 7std_A* | Back alignment and structure |
|---|
| >1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A | Back alignment and structure |
|---|
| >3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A | Back alignment and structure |
|---|
| >1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A | Back alignment and structure |
|---|
| >3gzx_B Biphenyl dioxygenase subunit beta; rieskie, non-heme iron, 2Fe-2S, aromatic hydroc catabolism, iron, iron-sulfur, metal-binding, NAD; HET: BNL MES; 1.58A {Comamonas testosteroni} SCOP: d.17.4.4 PDB: 3gzy_B* 2yfi_B 2xr8_B* 2xrx_B* 2xsh_B 2xso_B 2yfj_B* 2yfl_B* | Back alignment and structure |
|---|
| >2bmo_B Oxygenase-beta NBDO; nitrobenzene dioxygenase, nitroarene, rieske non-heme dioxygenase, substrate specificity iron- sulfur, metal-binding, NAD; 1.2A {Comamonas SP} SCOP: d.17.4.4 PDB: 2bmq_B 2bmr_B* 1o7n_B 1ndo_B 1o7g_B* 1o7h_B 1o7m_B 1eg9_B 1o7p_B* 1o7w_B 1uuv_B 1uuw_B 2hmj_B 2hmk_B* 2hml_B* 2hmm_B* 2hmn_B* 2hmo_B* | Back alignment and structure |
|---|
| >3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} SCOP: d.17.4.0 | Back alignment and structure |
|---|
| >1vqq_A Saupbp2A, penicillin-binding protein MECA, low-affinity; beta-lactam, D- transpeptidase, D-carboxypeptidase, biosynthetic protein; 1.80A {Staphylococcus aureus} SCOP: d.17.4.5 d.175.1.1 e.3.1.1 PDB: 1mwu_A* 1mwr_A 1mws_A* 1mwt_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 179 | ||||
| d1oh0a_ | 125 | d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, ste | 1e-09 | |
| d1m98a2 | 142 | d.17.4.6 (A:176-317) Orange carotenoid protein, C- | 2e-09 | |
| d2f99a1 | 140 | d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyc | 4e-07 | |
| d1ohpa1 | 125 | d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase | 8e-07 | |
| d1tuha_ | 131 | d.17.4.11 (A:) Hypothetical protein egc068 from a | 1e-06 | |
| d1s5aa_ | 139 | d.17.4.10 (A:) Hypothetical protein YesE {Bacillus | 4e-06 | |
| d2a15a1 | 132 | d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {M | 2e-05 | |
| d3ec9a1 | 130 | d.17.4.10 (A:10-139) Uncharacterized protein BTHI0 | 3e-05 | |
| d2k54a1 | 123 | d.17.4.29 (A:1-123) Uncharacterized protein Atu074 | 5e-05 | |
| d1nwwa_ | 145 | d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhod | 6e-05 | |
| d1z1sa1 | 129 | d.17.4.10 (A:1-129) Uncharacterized protein PA3332 | 8e-05 | |
| d3en8a1 | 127 | d.17.4.20 (A:1-127) Uncharacterized protein BxeB20 | 2e-04 | |
| d1sjwa_ | 142 | d.17.4.9 (A:) Nogalonic acid methyl ester cyclase | 2e-04 | |
| d3ebta1 | 131 | d.17.4.9 (A:1-131) Uncharacterized protein BPSS013 | 3e-04 | |
| d3dm8a1 | 135 | d.17.4.20 (A:1-135) Uncharacterized protein Rpa434 | 4e-04 | |
| d2gexa1 | 138 | d.17.4.9 (A:2-139) Nogalamycin biosynthesis protei | 6e-04 | |
| d2bnga1 | 132 | d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 | 7e-04 | |
| d2geya1 | 144 | d.17.4.9 (A:2-145) Putative hydroxylase AclR {Stre | 0.001 | |
| d3dmca1 | 133 | d.17.4.10 (A:1-133) Uncharacterized protein Ava226 | 0.004 |
| >d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} Length = 125 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cystatin-like superfamily: NTF2-like family: Ketosteroid isomerase-like domain: Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI species: Pseudomonas putida [TaxId: 303]
Score = 51.7 bits (123), Expect = 1e-09
Identities = 11/71 (15%), Positives = 28/71 (39%)
Query: 89 VVRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLDFFKKFSDSISSDLQFV 148
++ R+ ++ D+ ++ ++ ADD ED P GR+ F+++
Sbjct: 10 LMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLT 69
Query: 149 IDDISAEDSSA 159
++ +
Sbjct: 70 GPVRASHNGCG 80
|
| >d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} Length = 142 | Back information, alignment and structure |
|---|
| >d2f99a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]} Length = 140 | Back information, alignment and structure |
|---|
| >d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} Length = 125 | Back information, alignment and structure |
|---|
| >d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} Length = 131 | Back information, alignment and structure |
|---|
| >d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} Length = 139 | Back information, alignment and structure |
|---|
| >d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 132 | Back information, alignment and structure |
|---|
| >d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} Length = 130 | Back information, alignment and structure |
|---|
| >d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]} Length = 123 | Back information, alignment and structure |
|---|
| >d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Length = 145 | Back information, alignment and structure |
|---|
| >d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} Length = 129 | Back information, alignment and structure |
|---|
| >d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} Length = 127 | Back information, alignment and structure |
|---|
| >d1sjwa_ d.17.4.9 (A:) Nogalonic acid methyl ester cyclase SnoaL {Streptomyces nogalater [TaxId: 38314]} Length = 142 | Back information, alignment and structure |
|---|
| >d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} Length = 131 | Back information, alignment and structure |
|---|
| >d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} Length = 135 | Back information, alignment and structure |
|---|
| >d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} Length = 138 | Back information, alignment and structure |
|---|
| >d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 132 | Back information, alignment and structure |
|---|
| >d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]} Length = 144 | Back information, alignment and structure |
|---|
| >d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} Length = 133 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| d1m98a2 | 142 | Orange carotenoid protein, C-terminal domain {Cyan | 99.68 | |
| d1nwwa_ | 145 | Limonene-1,2-epoxide hydrolase {Rhodococcus erythr | 99.49 | |
| d2gexa1 | 138 | Nogalamycin biosynthesis protein SnoL {Streptomyce | 99.43 | |
| d3dxoa1 | 117 | Uncharacterized protein Atu0744 {Agrobacterium tum | 99.43 | |
| d1oh0a_ | 125 | Delta-5-3-ketosteroid isomerase, steroid delta-iso | 99.43 | |
| d2f99a1 | 140 | Aklanonic acid methyl ester cyclase, AknH {Strepto | 99.41 | |
| d2geya1 | 144 | Putative hydroxylase AclR {Streptomyces galilaeus | 99.4 | |
| d2k54a1 | 123 | Uncharacterized protein Atu0742 {Agrobacterium tum | 99.39 | |
| d3ebta1 | 131 | Uncharacterized protein BPSS0132 {Burkholderia pse | 99.38 | |
| d1ohpa1 | 125 | Delta-5-3-ketosteroid isomerase, steroid delta-iso | 99.37 | |
| d1z1sa1 | 129 | Uncharacterized protein PA3332 {Pseudomonas aerugi | 99.34 | |
| d1tuha_ | 131 | Hypothetical protein egc068 from a soil-derived mo | 99.33 | |
| d3dm8a1 | 135 | Uncharacterized protein Rpa4348 {Rhodopseudomonas | 99.32 | |
| d2a15a1 | 132 | Hypothetical protein Rv0760c {Mycobacterium tuberc | 99.32 | |
| d3en8a1 | 127 | Uncharacterized protein BxeB2092 {Burkholderia xen | 99.32 | |
| d2bnga1 | 132 | Uncharacterized protein Mb2760 {Mycobacterium tube | 99.3 | |
| d1sjwa_ | 142 | Nogalonic acid methyl ester cyclase SnoaL {Strepto | 99.29 | |
| d1s5aa_ | 139 | Hypothetical protein YesE {Bacillus subtilis [TaxI | 99.28 | |
| d3dmca1 | 133 | Uncharacterized protein Ava2261 {Anabaena variabil | 99.26 | |
| d3ec9a1 | 130 | Uncharacterized protein BTHI0051 {Burkholderia tha | 99.21 | |
| d3d9ra1 | 132 | Uncharacterized protein ECA1476 {Pectobacterium at | 98.99 | |
| d2gxfa1 | 128 | Hypothetical protein YybH {Bacillus subtilis [TaxI | 98.81 | |
| d3cu3a1 | 162 | Uncharacterized protein NpunR1993 {Nostoc punctifo | 98.65 | |
| d3b7ca1 | 121 | Uncharacterized protein SO0125 {Shewanella oneiden | 98.51 | |
| d2owpa1 | 128 | Hypothetical protein BxeB1374 {Burkholderia xenovo | 98.44 | |
| d3cnxa1 | 153 | Uncharacterized protein SAV4671 {Streptomyces aver | 98.43 | |
| d2rcda1 | 127 | Uncharacterized protein ECA3500 {Pectobacterium at | 98.4 | |
| d2rgqa1 | 133 | Uncharacterized protein NpunR3134 {Nostoc punctifo | 98.38 | |
| d3bb9a1 | 121 | Uncharacterized protein Sfri1973 {Shewanella frigi | 98.35 | |
| d2ux0a1 | 135 | Association domain of calcium/calmodulin-dependent | 98.21 | |
| d3b8la1 | 144 | Uncharacterized protein Saro3538 {Novosphingobium | 98.05 | |
| d3ef8a1 | 149 | Uncharacterized protein Saro1465 {Novosphingobium | 97.98 | |
| d3ejva1 | 159 | Uncharacterized protein Saro2766 {Novosphingobium | 97.88 | |
| d2chca1 | 167 | Uncharacterized protein Rv3472 {Mycobacterium tube | 97.84 | |
| d2r4ia1 | 122 | Uncharacterized protein CHU142 {Cytophaga hutchins | 97.48 | |
| d2f86b1 | 129 | Association domain of calcium/calmodulin-dependent | 97.4 | |
| d2imja1 | 155 | Hypothetical protein PFL3262 {Pseudomonas fluoresc | 97.39 | |
| d2rfra1 | 153 | Uncharacterized protein Saro3722 {Novosphingobium | 97.34 | |
| d3ebya1 | 157 | Putative hydroxylase subunit Saro3860 {Novosphingo | 96.72 | |
| d1m98a1 | 174 | Orange carotenoid protein, N-terminal domain {Cyan | 96.63 | |
| d3blza1 | 124 | Uncharacterized protein Sbal0622 {Shewanella balti | 96.6 | |
| d3er7a1 | 118 | Uncharacterized protein Exig0174 {Exiguobacterium | 96.05 | |
| d3e99a1 | 163 | Benzoate 1,2-dioxygenase beta subunit BenB {Burkho | 95.82 | |
| d1idpa_ | 147 | Scytalone dehydratase {Fungus (Magnaporthe grisea) | 95.47 | |
| d2qiya1 | 139 | UBP3-associated protein BRE5 {Baker's yeast (Sacch | 94.89 | |
| d3ecfa1 | 128 | Uncharacterized protein Ava4193 {Anabaena variabil | 94.77 | |
| d1wqlb1 | 182 | Small subunit of cumene dioxygenase CumA2 {Pseudom | 94.46 | |
| d1zo2a1 | 117 | Nuclear transport factor-2 (NTF2) {Cryptosporidium | 94.36 | |
| d1ulib_ | 177 | Biphenyl dioxygenase small subunit BphA2 {Rhodococ | 93.79 | |
| d1gy6a_ | 125 | Nuclear transport factor-2 (NTF2) {Rat (Rattus nor | 93.18 | |
| d1tp6a_ | 126 | Hypothetical protein PA1314 {Pseudomonas aeruginos | 92.85 | |
| d1jkga_ | 139 | NTF2-related export protein 1 (p15) {Human (Homo s | 91.23 | |
| d1gy7a_ | 121 | Nuclear transport factor-2 (NTF2) {Baker's yeast ( | 90.97 | |
| d2b1xb1 | 167 | Naphthalene 1,2-dioxygenase beta subunit {Rhodococ | 90.9 | |
| d1vqqa1 | 112 | Penicillin binding protein 2a (PBP2A), N-terminal | 87.53 |
| >d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cystatin-like superfamily: NTF2-like family: Orange carotenoid protein, C-terminal domain domain: Orange carotenoid protein, C-terminal domain species: Cyanobacteria (Arthrospira maxima) [TaxId: 129910]
Probab=99.68 E-value=1.9e-17 Score=128.13 Aligned_cols=96 Identities=17% Similarity=0.322 Sum_probs=80.6
Q ss_pred CC-CCCCCCCCCCC----CcHHHHHHHHHHHHhCCCHHHHHhhhccCceEeeCCCCCCccCHHHHHHHHHHHHHhcCCCe
Q 030318 71 SP-LPTTSNVDGDD----GGGAVVVRRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKATLDFFKKFSDSISSDL 145 (179)
Q Consensus 71 ~p-~~~t~~~~~~~----~~~~~vVrrfyeA~Na~D~dal~eLfApD~v~~dp~~~~Pi~Greav~~ff~~~~~afp~dl 145 (179)
|| +||++++++.+ +..+.+|++||+++|++|++++.+||++|+++++| +++|++|++++++||++.++++....
T Consensus 1 ~~~~~p~~~~~r~~~~~~~i~~~~V~~Y~~a~na~D~d~~~~lFa~Dav~~~P-~~~p~~G~eaI~~f~~~~~~~~~~~p 79 (142)
T d1m98a2 1 EPVVPPQEMSQRTKVQIEGVTNSTVLQYMDNLNANDFDNLISLFAEDGALQPP-FQKPIVGKENTLRFFREECQNLKLIP 79 (142)
T ss_dssp CCCCCCCCGGGCCCCCBBTBCCHHHHHHHHHHHTTCHHHHHTTEEEEEEEECT-TSCCEESHHHHHHHHHHHCTTCEEEE
T ss_pred CCcCCCCCCCcccccccccccHHHHHHHHHHHhcCCHHHHHHHcCCCeEEeCC-CCccccCHHHHHHHHHHhcccceecc
Confidence 67 88888888733 67888999999999999999999999999999975 56799999999999999998886555
Q ss_pred EEEEEeeecCCCceEEEEEEEE
Q 030318 146 QFVIDDISAEDSSANGKESHFL 167 (179)
Q Consensus 146 ~~~I~ev~egD~~aV~v~w~le 167 (179)
+.++.+..++++.++.++++++
T Consensus 80 ~~g~~~~~~~g~~~v~vtgkV~ 101 (142)
T d1m98a2 80 ERGVSEPTEDGYTQIKVTGKVQ 101 (142)
T ss_dssp EEEEEEECGGGCEEEEEEEEEE
T ss_pred cceeeEeecCCcEEEEEEEEEe
Confidence 5666666666677888887654
|
| >d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} | Back information, alignment and structure |
|---|
| >d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2f99a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]} | Back information, alignment and structure |
|---|
| >d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]} | Back information, alignment and structure |
|---|
| >d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} | Back information, alignment and structure |
|---|
| >d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sjwa_ d.17.4.9 (A:) Nogalonic acid methyl ester cyclase SnoaL {Streptomyces nogalater [TaxId: 38314]} | Back information, alignment and structure |
|---|
| >d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} | Back information, alignment and structure |
|---|
| >d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} | Back information, alignment and structure |
|---|
| >d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} | Back information, alignment and structure |
|---|
| >d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b8la1 d.17.4.28 (A:1-144) Uncharacterized protein Saro3538 {Novosphingobium aromaticivorans [TaxId: 48935]} | Back information, alignment and structure |
|---|
| >d3ef8a1 d.17.4.28 (A:1-149) Uncharacterized protein Saro1465 {Novosphingobium aromaticivorans [TaxId: 48935]} | Back information, alignment and structure |
|---|
| >d3ejva1 d.17.4.28 (A:2-160) Uncharacterized protein Saro2766 {Novosphingobium aromaticivorans [TaxId: 48935]} | Back information, alignment and structure |
|---|
| >d2chca1 d.17.4.25 (A:1-167) Uncharacterized protein Rv3472 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} | Back information, alignment and structure |
|---|
| >d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2imja1 d.17.4.23 (A:5-159) Hypothetical protein PFL3262 {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2rfra1 d.17.4.28 (A:1-153) Uncharacterized protein Saro3722 {Novosphingobium aromaticivorans [TaxId: 48935]} | Back information, alignment and structure |
|---|
| >d3ebya1 d.17.4.4 (A:6-162) Putative hydroxylase subunit Saro3860 {Novosphingobium aromaticivorans [TaxId: 48935]} | Back information, alignment and structure |
|---|
| >d1m98a1 a.175.1.1 (A:2-175) Orange carotenoid protein, N-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} | Back information, alignment and structure |
|---|
| >d3blza1 d.17.4.14 (A:3-126) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]} | Back information, alignment and structure |
|---|
| >d3er7a1 d.17.4.24 (A:5-122) Uncharacterized protein Exig0174 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]} | Back information, alignment and structure |
|---|
| >d3e99a1 d.17.4.4 (A:1-163) Benzoate 1,2-dioxygenase beta subunit BenB {Burkholderia mallei [TaxId: 13373]} | Back information, alignment and structure |
|---|
| >d1idpa_ d.17.4.1 (A:) Scytalone dehydratase {Fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3ecfa1 d.17.4.21 (A:2-129) Uncharacterized protein Ava4193 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d1wqlb1 d.17.4.4 (B:5-186) Small subunit of cumene dioxygenase CumA2 {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1ulib_ d.17.4.4 (B:) Biphenyl dioxygenase small subunit BphA2 {Rhodococcus sp. (strain RHA1) [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tp6a_ d.17.4.12 (A:) Hypothetical protein PA1314 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b1xb1 d.17.4.4 (B:513-679) Naphthalene 1,2-dioxygenase beta subunit {Rhodococcus sp. ncimb12038 [TaxId: 92694]} | Back information, alignment and structure |
|---|
| >d1vqqa1 d.17.4.5 (A:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|