Citrus Sinensis ID: 030327

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18

MALLHSSMTATPRAFTCKSVSVGKVASFPPPLVNFASPSSYSPCSLTGVTNNLRLLGVKSNKATTFRCLAAALTPELKSTLDKVVTGNKVVLFMKGTKDFPQCGFSHTVVQILKSLNAPFETVNILENEMLRQGLKEYSSWPTFPQLYIEGEFFGGCDITVEAYKNGELQELLEKALCT

cccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccHHHHHHHHccHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHccccccEEEcccccHHHHHcccccccccccccEEccEEccHHHHHHHHHHcccHHHHHHHHHcc

*****************************P*****************************************ALTPELKSTLDKVVTGNKVVLFMKGTKDFPQCGFSHTVVQILKSLNAPFETVNILENEMLRQGLKEYSSWPTFPQLYIEGEFFGGCDITVEAYKNGELQELLEKALC*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MALLHSSMTATPRAFTCKSVSVGKVASFPPPLVNFASPSSYSPCSLTGVTNNLRLLGVKSNKATTFRCLAAALTPELKSTLDKVVTGNKVVLFMKGTKDFPQCGFSHTVVQILKSLNAPFETVNILENEMLRQGLKEYSSWPTFPQLYIEGEFFGGCDITVEAYKNGELQELLEKALCT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Monothiol glutaredoxin-S14, chloroplastic	May only reduce GSH-thiol disulfides, but not protein disulfides (Potential). May protect cells against protein oxidative damage. May regulate CAX cation transporters.	probable	Q84Y95
Monothiol glutaredoxin-S7, chloroplastic	May only reduce GSH-thiol disulfides, but not protein disulfides.	probable	Q851Y7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IPZ, chain A
Confidence level:very confident
Coverage over the Query: 72-179
View the alignment between query and template
View the model in PyMOL