Citrus Sinensis ID: 030331
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 179 | ||||||
| 356544962 | 211 | PREDICTED: transcription factor bHLH36-l | 0.865 | 0.734 | 0.557 | 7e-45 | |
| 356543837 | 222 | PREDICTED: transcription factor bHLH36-l | 0.826 | 0.666 | 0.572 | 2e-41 | |
| 147822237 | 174 | hypothetical protein VITISV_010916 [Viti | 0.843 | 0.867 | 0.535 | 2e-41 | |
| 359496902 | 152 | PREDICTED: transcription factor bHLH36-l | 0.837 | 0.986 | 0.532 | 6e-41 | |
| 356515176 | 224 | PREDICTED: transcription factor bHLH36-l | 0.865 | 0.691 | 0.535 | 4e-40 | |
| 224125352 | 183 | predicted protein [Populus trichocarpa] | 0.826 | 0.808 | 0.537 | 3e-39 | |
| 302143302 | 215 | unnamed protein product [Vitis vinifera] | 0.832 | 0.693 | 0.552 | 4e-39 | |
| 225446384 | 206 | PREDICTED: transcription factor bHLH118- | 0.832 | 0.723 | 0.552 | 4e-39 | |
| 255536797 | 210 | DNA binding protein, putative [Ricinus c | 0.810 | 0.690 | 0.536 | 2e-38 | |
| 224121740 | 218 | predicted protein [Populus trichocarpa] | 0.893 | 0.733 | 0.542 | 6e-38 |
| >gi|356544962|ref|XP_003540915.1| PREDICTED: transcription factor bHLH36-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 185 bits (469), Expect = 7e-45, Method: Compositional matrix adjust.
Identities = 87/156 (55%), Positives = 121/156 (77%), Gaps = 1/156 (0%)
Query: 22 SSPTKIERKTIEKNRRDQMKNLYSTLKSLLPNQPSKEELSLPDQVDEAINYIKMLETKLK 81
SS TK+ER+ +EKNRR+QMKNLY+ L SLLP+ KE L LPDQVDEAINYIK LE K+K
Sbjct: 10 SSSTKVERRLVEKNRRNQMKNLYNKLNSLLPSYNPKEALPLPDQVDEAINYIKSLEAKVK 69
Query: 82 ECKKRKESLQG-RERSHACISDGTEARLMTSSSPKAPEIEIHEMGSNLEVILTSGVDDQF 140
+++KE+LQG R+RS C S+ + TS PK+P++EIHE+GS+L+V+LT G+D QF
Sbjct: 70 MAQEKKENLQGIRKRSRGCFSNNSANFAATSGFPKSPQLEIHEVGSSLQVVLTCGLDHQF 129
Query: 141 IFYEVIRILHQDGAEILNAKFSVVGNTIFHVIHAEV 176
IFYE+I+ILH++ E+ + S+ G+++ HV+HAE+
Sbjct: 130 IFYEIIQILHEENIEVRSVNSSLAGDSVLHVVHAEI 165
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356543837|ref|XP_003540366.1| PREDICTED: transcription factor bHLH36-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147822237|emb|CAN61967.1| hypothetical protein VITISV_010916 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359496902|ref|XP_003635365.1| PREDICTED: transcription factor bHLH36-like, partial [Vitis vinifera] gi|296086982|emb|CBI33238.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356515176|ref|XP_003526277.1| PREDICTED: transcription factor bHLH36-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224125352|ref|XP_002329784.1| predicted protein [Populus trichocarpa] gi|222870846|gb|EEF07977.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|302143302|emb|CBI21863.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225446384|ref|XP_002274262.1| PREDICTED: transcription factor bHLH118-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255536797|ref|XP_002509465.1| DNA binding protein, putative [Ricinus communis] gi|223549364|gb|EEF50852.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224121740|ref|XP_002330641.1| predicted protein [Populus trichocarpa] gi|222872245|gb|EEF09376.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 179 | ||||||
| TAIR|locus:2133089 | 190 | AT4G20970 "AT4G20970" [Arabido | 0.910 | 0.857 | 0.401 | 5.6e-29 | |
| TAIR|locus:2165311 | 174 | AT5G51780 "AT5G51780" [Arabido | 0.843 | 0.867 | 0.309 | 4.9e-14 | |
| UNIPROTKB|Q941Z7 | 248 | P0431G06.13-1 "BHLH transcript | 0.860 | 0.620 | 0.265 | 5e-12 | |
| TAIR|locus:2138019 | 163 | AT4G25400 "AT4G25400" [Arabido | 0.770 | 0.846 | 0.296 | 2e-10 | |
| TAIR|locus:2080600 | 253 | bHLH38 "basic helix-loop-helix | 0.810 | 0.573 | 0.246 | 4.5e-09 | |
| TAIR|locus:4515102513 | 174 | AT1G10586 [Arabidopsis thalian | 0.798 | 0.821 | 0.243 | 7.6e-09 | |
| TAIR|locus:504956298 | 259 | AT1G62975 "AT1G62975" [Arabido | 0.491 | 0.339 | 0.315 | 6.9e-07 | |
| TAIR|locus:2146663 | 240 | BHLH101 "AT5G04150" [Arabidops | 0.832 | 0.620 | 0.233 | 7.9e-07 | |
| TAIR|locus:2080615 | 258 | bHLH39 "basic helix-loop-helix | 0.810 | 0.562 | 0.253 | 9.9e-07 | |
| TAIR|locus:505006117 | 181 | AT1G10585 [Arabidopsis thalian | 0.787 | 0.779 | 0.243 | 1.2e-06 |
| TAIR|locus:2133089 AT4G20970 "AT4G20970" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 322 (118.4 bits), Expect = 5.6e-29, P = 5.6e-29
Identities = 67/167 (40%), Positives = 107/167 (64%)
Query: 14 MKRKQCSSSSPTKIERKTIEKNRRDQMKNLYSTLKSLLPNQPSKEELSLPDQVDEAINYI 73
M+ ++ ++RKT+EKNRR QMK+LYS L SLLP+ S E L+LPDQ+DEA NYI
Sbjct: 1 MEPSHSNTGQSRSVDRKTVEKNRRMQMKSLYSELISLLPHHSSTEPLTLPDQLDEAANYI 60
Query: 74 KMLETKLKECKKRKESLQGR---ERSHACISDGTEARLMTSSSPKAPEIEIHEMGSNLEV 130
K L+ +++ ++RK +L E+ ++ S + + S K P+IEI E GS +
Sbjct: 61 KKLQVNVEKKRERKRNLVATTTLEKLNSVGSSSVSSSVDVSVPRKLPKIEIQETGSIFHI 120
Query: 131 ILTSGVDDQFIFYEVIRILHQD-GAEILNAKFSVVGNTIFHVIHAEV 176
L + ++ +F+F E+IR+L ++ GAEI +A +S+V + +FH +H +V
Sbjct: 121 FLVTSLEHKFMFCEIIRVLTEELGAEITHAGYSIVDDAVFHTLHCKV 167
|
|
| TAIR|locus:2165311 AT5G51780 "AT5G51780" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q941Z7 P0431G06.13-1 "BHLH transcription factor-like" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2138019 AT4G25400 "AT4G25400" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2080600 bHLH38 "basic helix-loop-helix 38" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:4515102513 AT1G10586 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504956298 AT1G62975 "AT1G62975" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146663 BHLH101 "AT5G04150" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2080615 bHLH39 "basic helix-loop-helix 39" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006117 AT1G10585 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 179 | |||
| pfam00010 | 52 | pfam00010, HLH, Helix-loop-helix DNA-binding domai | 4e-09 | |
| cd00083 | 60 | cd00083, HLH, Helix-loop-helix domain, found in sp | 3e-07 | |
| smart00353 | 53 | smart00353, HLH, helix loop helix domain | 7e-06 |
| >gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain | Back alignment and domain information |
|---|
Score = 49.8 bits (120), Expect = 4e-09
Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
Query: 32 IEKNRRDQMKNLYSTLKSLLPNQPSKEELSLPDQVDEAINYIKMLE 77
E+ RRD++ + + L+ LLP P+K +LS + + AI YIK L+
Sbjct: 8 RERRRRDRINDAFEELRELLPTPPNK-KLSKAEILRLAIEYIKHLQ 52
|
Length = 52 |
| >gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >gnl|CDD|197674 smart00353, HLH, helix loop helix domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| PF00010 | 55 | HLH: Helix-loop-helix DNA-binding domain only nucl | 99.52 | |
| cd00083 | 60 | HLH Helix-loop-helix domain, found in specific DNA | 99.5 | |
| smart00353 | 53 | HLH helix loop helix domain. | 99.43 | |
| KOG1318 | 411 | consensus Helix loop helix transcription factor EB | 98.97 | |
| KOG2483 | 232 | consensus Upstream transcription factor 2/L-myc-2 | 98.89 | |
| KOG1319 | 229 | consensus bHLHZip transcription factor BIGMAX [Tra | 98.84 | |
| KOG4304 | 250 | consensus Transcriptional repressors of the hairy/ | 98.43 | |
| KOG4029 | 228 | consensus Transcription factor HAND2/Transcription | 98.29 | |
| KOG0561 | 373 | consensus bHLH transcription factor [Transcription | 98.28 | |
| PLN03217 | 93 | transcription factor ATBS1; Provisional | 98.28 | |
| KOG3561 | 803 | consensus Aryl-hydrocarbon receptor nuclear transl | 98.27 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 97.65 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 97.59 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 97.55 | |
| KOG3960 | 284 | consensus Myogenic helix-loop-helix transcription | 97.54 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 97.47 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 97.26 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 97.23 | |
| KOG2588 | 953 | consensus Predicted DNA-binding protein [Transcrip | 97.21 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 97.2 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 97.15 | |
| KOG3898 | 254 | consensus Transcription factor NeuroD and related | 97.01 | |
| KOG4447 | 173 | consensus Transcription factor TWIST [Transcriptio | 96.95 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 96.84 | |
| KOG3910 | 632 | consensus Helix loop helix transcription factor [T | 96.24 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 96.2 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 96.16 | |
| KOG4395 | 285 | consensus Transcription factor Atonal, contains HT | 96.15 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 96.13 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 96.05 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 95.97 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 95.66 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 95.63 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 95.52 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 95.43 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 95.26 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 95.19 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 95.18 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 94.89 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 94.47 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 94.35 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 94.3 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 94.0 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 93.98 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 93.91 | |
| PRK00194 | 90 | hypothetical protein; Validated | 93.87 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 93.71 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 93.71 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 93.66 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 93.64 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 93.25 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 93.14 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 92.97 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 92.64 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 91.93 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 91.44 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 91.18 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 91.03 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 90.52 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 90.37 | |
| KOG3558 | 768 | consensus Hypoxia-inducible factor 1/Neuronal PAS | 89.88 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 89.01 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 88.91 | |
| KOG3559 | 598 | consensus Transcriptional regulator SIM1 [Transcri | 88.16 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 88.1 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 87.85 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 87.25 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 86.88 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 86.27 | |
| KOG3560 | 712 | consensus Aryl-hydrocarbon receptor [Transcription | 86.14 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 84.64 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 84.42 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 84.29 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 84.07 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 83.95 | |
| KOG4447 | 173 | consensus Transcription factor TWIST [Transcriptio | 83.92 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 83.27 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 82.77 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 82.13 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 81.29 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 81.14 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 81.06 |
| >PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) | Back alignment and domain information |
|---|
Probab=99.52 E-value=3.6e-14 Score=92.26 Aligned_cols=53 Identities=32% Similarity=0.572 Sum_probs=48.3
Q ss_pred hhhhhhHHHHHHHHHHHHHHHHHHhcCCCC--CCCCCCChhHHHHHHHHHHHHHH
Q 030331 25 TKIERKTIEKNRRDQMKNLYSTLKSLLPNQ--PSKEELSLPDQVDEAINYIKMLE 77 (179)
Q Consensus 25 ~r~~h~~~ER~RR~~mn~~~~~LrsllP~~--~~~~k~S~~~~l~~Ai~YIk~L~ 77 (179)
+|..|+..||+||..||+.|..|+.+||.. ....|.+.++||..||+||++||
T Consensus 1 rR~~h~~~Er~RR~~i~~~~~~L~~llp~~~~~~~~k~~K~~iL~~ai~yI~~Lq 55 (55)
T PF00010_consen 1 RRQKHNERERRRRDRINDCFDELRELLPSCSAGSSRKLSKASILQKAIDYIKQLQ 55 (55)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHCCSSHHCCTTSSSSHHHHHHHHHHHHHHHH
T ss_pred CCchHHHHHHHHHHHHHHHHHHHHHhccchhccccccCCHHHHHHHHHHHHHHhC
Confidence 578999999999999999999999999996 25567888999999999999997
|
; InterPro: IPR011598 The helix-loop-helix (HLH) DNA-binding domain consists of a closed bundle of four helices in a left-handed twist with two crossover connections. The HLH domain directs dimerisation, and is juxtaposed to basic regions to create a DNA interaction interface surface that recognises specific DNA sequences. Basic region/HLH (bHLH) proteins regulate diverse biological pathways []. bHLH proteins include MyoD [], SREBPs (sterol regulatory element binding proteins) [], and yeast Pho4 (phosphatase system) []. In certain proteins the bHLH domain contains a leucine-zipper motif. The bHLH/leucine zipper (bHLHZip) domain specifies dimerisation within a network of proteins and determines sequence-specific DNA binding []. bHLHZip domains occur in the transcription factors Myc, Mad, Max and Usf [, ]. This entry is bHLHZip, which covers the bHLH domain and the leucine zipper motif, when present.; PDB: 1NLW_A 1NKP_D 1A93_A 2A93_A 1AM9_C 3U5V_A 1A0A_B 2QL2_C 1UKL_C 1AN4_B .... |
| >cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >smart00353 HLH helix loop helix domain | Back alignment and domain information |
|---|
| >KOG1318 consensus Helix loop helix transcription factor EB [Transcription] | Back alignment and domain information |
|---|
| >KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] | Back alignment and domain information |
|---|
| >KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] | Back alignment and domain information |
|---|
| >KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] | Back alignment and domain information |
|---|
| >KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] | Back alignment and domain information |
|---|
| >KOG0561 consensus bHLH transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PLN03217 transcription factor ATBS1; Provisional | Back alignment and domain information |
|---|
| >KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG2588 consensus Predicted DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG4447 consensus Transcription factor TWIST [Transcription] | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >KOG3910 consensus Helix loop helix transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >KOG3559 consensus Transcriptional regulator SIM1 [Transcription] | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >KOG4447 consensus Transcription factor TWIST [Transcription] | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 179 | |||
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 1e-07 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 9e-07 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 4e-06 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 6e-06 | |
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 6e-05 |
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 | Back alignment and structure |
|---|
Score = 46.2 bits (110), Expect = 1e-07
Identities = 12/64 (18%), Positives = 32/64 (50%)
Query: 30 KTIEKNRRDQMKNLYSTLKSLLPNQPSKEELSLPDQVDEAINYIKMLETKLKECKKRKES 89
+E+ RR+++K + L+ +P + E+ + +A YI ++ + ++ ++
Sbjct: 11 NVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDL 70
Query: 90 LQGR 93
L+ R
Sbjct: 71 LRKR 74
|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 99.72 | |
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 99.69 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 99.68 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 99.67 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 99.67 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 99.63 | |
| 3u5v_A | 76 | Protein MAX, transcription factor E2-alpha chimer; | 99.59 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 99.57 | |
| 4ati_A | 118 | MITF, microphthalmia-associated transcription fact | 99.57 | |
| 2ql2_B | 60 | Neurod1, neurogenic differentiation factor 1; basi | 99.55 | |
| 4h10_B | 71 | Circadian locomoter output cycles protein kaput; B | 99.53 | |
| 1mdy_A | 68 | Protein (MYOD BHLH domain); protein-DNA complex, t | 99.47 | |
| 4h10_A | 73 | ARYL hydrocarbon receptor nuclear translocator-LI | 99.43 | |
| 2lfh_A | 68 | DNA-binding protein inhibitor ID-3; structural gen | 99.14 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 98.91 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 98.77 | |
| 4aya_A | 97 | DNA-binding protein inhibitor ID-2; cell cycle; 2. | 98.75 | |
| 4ath_A | 83 | MITF, microphthalmia-associated transcription fact | 98.5 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 95.66 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 93.68 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 90.66 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 87.87 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 87.16 | |
| 3he4_B | 46 | Synzip5; heterodimeric coiled-coil, de novo protei | 81.76 |
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
Probab=99.72 E-value=3.5e-17 Score=113.83 Aligned_cols=68 Identities=25% Similarity=0.331 Sum_probs=62.7
Q ss_pred hhhhhhHHHHHHHHHHHHHHHHHHhcCCCCCCCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Q 030331 25 TKIERKTIEKNRRDQMKNLYSTLKSLLPNQPSKEELSLPDQVDEAINYIKMLETKLKECKKRKESLQG 92 (179)
Q Consensus 25 ~r~~h~~~ER~RR~~mn~~~~~LrsllP~~~~~~k~S~~~~l~~Ai~YIk~L~~~v~~L~~~~~~~~~ 92 (179)
.|..||..||+||..||++|..|+++||......|.|.++||..|++||++|+++.+.|..+++.+..
T Consensus 1 ~R~~HN~~ER~RR~~lk~~f~~Lr~~vP~~~~~~k~sk~~iL~kA~~yI~~L~~~~~~l~~e~~~L~~ 68 (80)
T 1nlw_A 1 SRSTHNEMEKNRRAHLRLSLEKLKGLVPLGPDSSRHTTLSLLTKAKLHIKKLEDSDRKAVHQIDQLQR 68 (80)
T ss_dssp CHHHHHHHHHHHHHHHHHHHHHHHHSSCCCSSSCCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred CcchHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 37899999999999999999999999999877788999999999999999999999999998877653
|
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A | Back alignment and structure |
|---|
| >2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* | Back alignment and structure |
|---|
| >4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3he4_B Synzip5; heterodimeric coiled-coil, de novo protein; 2.46A {Artificial gene} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 179 | ||||
| d1nkpa_ | 88 | a.38.1.1 (A:) Myc proto-oncogene protein {Human (H | 4e-11 | |
| d1nlwa_ | 79 | a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T | 1e-09 | |
| d1mdya_ | 68 | a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul | 1e-08 | |
| d1nkpb_ | 83 | a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T | 1e-06 | |
| d1a0aa_ | 63 | a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa | 1e-06 | |
| d1am9a_ | 80 | a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI | 1e-06 | |
| d1uklc_ | 61 | a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId | 1e-05 | |
| d1an4a_ | 65 | a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien | 1e-04 |
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: Myc proto-oncogene protein species: Human (Homo sapiens) [TaxId: 9606]
Score = 54.5 bits (131), Expect = 4e-11
Identities = 12/71 (16%), Positives = 33/71 (46%)
Query: 26 KIERKTIEKNRRDQMKNLYSTLKSLLPNQPSKEELSLPDQVDEAINYIKMLETKLKECKK 85
+ +E+ RR+++K + L+ +P + E+ + +A YI ++ + ++
Sbjct: 7 RRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLIS 66
Query: 86 RKESLQGRERS 96
++ L+ R
Sbjct: 67 EEDLLRKRREQ 77
|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 179 | |||
| d1nlwa_ | 79 | Mad protein {Human (Homo sapiens) [TaxId: 9606]} | 99.71 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 99.69 | |
| d1am9a_ | 80 | SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | 99.65 | |
| d1mdya_ | 68 | Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 | 99.64 | |
| d1nkpb_ | 83 | Max protein {Human (Homo sapiens) [TaxId: 9606]} | 99.64 | |
| d1a0aa_ | 63 | Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce | 99.6 | |
| d1an4a_ | 65 | Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 | 99.49 | |
| d1uklc_ | 61 | SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.37 | |
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 96.04 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 95.71 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 92.16 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 90.87 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 88.55 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 87.24 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 84.23 |
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: Mad protein species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.71 E-value=1.8e-17 Score=113.16 Aligned_cols=67 Identities=25% Similarity=0.329 Sum_probs=61.9
Q ss_pred hhhhhHHHHHHHHHHHHHHHHHHhcCCCCCCCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Q 030331 26 KIERKTIEKNRRDQMKNLYSTLKSLLPNQPSKEELSLPDQVDEAINYIKMLETKLKECKKRKESLQG 92 (179)
Q Consensus 26 r~~h~~~ER~RR~~mn~~~~~LrsllP~~~~~~k~S~~~~l~~Ai~YIk~L~~~v~~L~~~~~~~~~ 92 (179)
|..||..||+||..||+.|..|+++||......|.|.++||..||+||+.|+++++.|..+++.+..
T Consensus 2 R~~Hn~~Er~RR~~in~~f~~L~~llP~~~~~~k~sK~~iL~~A~~yI~~L~~~~~~l~~~~~~L~~ 68 (79)
T d1nlwa_ 2 RSTHNEMEKNRRAHLRLSLEKLKGLVPLGPDSSRHTTLSLLTKAKLHIKKLEDSDRKAVHQIDQLQR 68 (79)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHSSCCCSSSCCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHHhCccCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 6899999999999999999999999998877778899999999999999999999999988877653
|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|