Citrus Sinensis ID: 030364

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18

MARTSNKNIQVKLVLLGDMGTGKTSLVLRFVKGQFFDFQESTIGAAFFTQVLSLNEVTIKFDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITSMDSFERAKKWVQELQRQGNPNLIMFLVANKVDLEEKRKVKNEEGELYAQENGLSFLETSAKSAHNVNELFYEIGDCTECFSLQT

ccccccccEEEEEEEEccccccHHHHHHHHHcccccccccccccEEEEccEEEEccEEEEEEEEEccccccccccccHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccccccHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHcccccccc

******K*IQVKLVLLGDMGTGKTSLVLRFVKGQFFDFQESTIGAAFFTQVLSLNEVTIKFDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITSMDSFERAKKWVQELQRQGNPNLIMFLVANKVDLEEKRKVKNEEGELYAQENGLSFLETSAKSAHNVNELFYEIGDCTECFS***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MARTSNKNIQVKLVLLGDMGTGKTSLVLRFVKGQFFDFQESTIGAAFFTQVLSLNEVTIKFDIWDTAGQERYHSLAPMYYRGAAAAVVVYDITSMDSFERAKKWVQELQRQGNPNLIMFLVANKVDLEEKRKVKNEEGELYAQENGLSFLETSAKSAHNVNELFYEIGDCTECFSLQT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ras-related protein RABF2a	Involved in the trafficking of soluble cargo proteins from the prevacuolar compartment to the central vacuole.	confident	P31582
Ras-related protein Rab-5A	Required for the fusion of plasma membranes and early endosomes.	probable	Q86JP3
Ras-related protein RHN1	Protein transport. Probably involved in vesicular traffic.	probable	P31583

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EFE, chain B
Confidence level:very confident
Coverage over the Query: 8-172
View the alignment between query and template
View the model in PyMOL