Citrus Sinensis ID: 030370

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18

MCTISIFPYWLIGFYLACWPVILVGRSLLGGLGNNLSGLSSTSHEMASGNFLSQQQRTFIQMRTVLKVVDNSGAKTVMCIQPLKGRKVARLGDTIVASVKEAMPTGKVKKGQVVHAVVVRAAMQHGRFDGSEVRFDDNAVVLVNKAGEPTGTRVFGPVPHELRRKKHVSILTLAEHLA

ccEEEccHHHHHHHHHHHcHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEECccccccEEEEEEECccccccccccEEEEEEEccccccccCCccEEEEEEEEEEccEEcccccEEECcccEEEEEccccccccCEEcccHHHHHHcccccEEEEcccccc

*CTISIFPYWLIGFYLACWPVILVGRSLLGGLGNNL******************QQRTFIQMRTVLKVVDNSGAKTVMCIQPLKGRKVARLGDTIVASVKEAMPTGKVKKGQVVHAVVVRAAMQHGRFDGSEVRFDDNAVVLVNKAGEPTGTRVFGPVPHELRRKKHVSILTLAEHL*

xxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MCTISIFPYWLIGFYLACWPVILVGRSLLGGLGNNLSGLSSTSHEMASGNFLSQQQRTFIQMRTVLKVVDNSGAKTVMCIQPLKGRKVARLGDTIVASVKEAMPTGKVKKGQVVHAVVVRAAMQHGRFDGSEVRFDDNAVVLVNKAGEPTGTRVFGPVPHELRRKKHVSILTLAEHLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
50S ribosomal protein L14	Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome.	probable	B8G6R5
50S ribosomal protein L14	Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome.	probable	B4R8M7
50S ribosomal protein L14	Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome.	probable	A5ELL7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain M
Confidence level:very confident
Coverage over the Query: 59-178
View the alignment between query and template
View the model in PyMOL