Citrus Sinensis ID: 030371


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MSGDRDPLVIGRVVGDVLDNFTRTIPLMVTYSGKDVKNGCELKPSAVINQPRVEIGGDDLRTFYTLVMVDPDAPSPSDPGLREYLHWLVTDIPETTEASFGKEIVSYESPRPTVGIHRFVFVLFRQHVKQNVCAPGWRQNFSCKDFAELYNLGSPVAAVYFNCQRETGSSASRRPVKK
cccccccccccccccccccccccccEEEEEEccEEEccccECcccccccccEEEEcccccccEEEEEEEcccccccccccccEEEEEEEEccccccccccccEEEECcccccccccccEEEEEEEcccccccccccccccccHHHHHHHHcccccEEEEEEEEECccccccccccccc
*****DPLVIGRVVGDVLDNFTRTIPLMVTYSGKDVKNGCELKPSAVINQPRVEIGGDDLRTFYTLVMVDPDAPSPSDPGLREYLHWLVTDIPETTEASFGKEIVSYESPRPTVGIHRFVFVLFRQHVKQNVCAPGWRQNFSCKDFAELYNLGSPVAAVYFNCQR*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGDRDPLVIGRVVGDVLDNFTRTIPLMVTYSGKDVKNGCELKPSAVINQPRVEIGGDDLRTFYTLVMVDPDAPSPSDPGLREYLHWLVTDIPETTEASFGKEIVSYESPRPTVGIHRFVFVLFRQHVKQNVCAPGWRQNFSCKDFAELYNLGSPVAAVYFNCQRETGSSASRRPVKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein HEADING DATE 3A Probable mobile flower-promoting signal (florigen) that moves from the leaf to the shoot apical meristem (SAM) and induces flowering. Promotes the transition from vegetative growth to flowering downstream of HD1 and EHD1 under short day (SD) conditions. Acts upstream of MADS14 and MADS15.confidentQ93WI9
Protein FLOWERING LOCUS T Probable component of the mobile flower-promoting signal (floral stimulus or florigen). Promotes the transition from vegetative growth to flowering. Required for 'SEPALLATA3' (SEP3) and 'FRUITFULL' (FUL) accumulation in mature rosette leaves. Seems to acts in parallel with 'LEAFY' to induce flowering by regulating 'APETALA1'. May play a role in both the autonomous and the long-day flowering pathways.probableQ9SXZ2
Protein SELF-PRUNING Not known. In plants homozygous for the recessive allele of the SP gene, sympodial segments develop progressively fewer nodes until the shoot is terminated by two consecutive. inflorescences.probableO82088

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AXY, chain A
Confidence level:very confident
Coverage over the Query: 20-167
View the alignment between query and template
View the model in PyMOL