Citrus Sinensis ID: 030405

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKVLSLIQLI
cccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccc
**QCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKVLSLIQLI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKVLSLIQLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcineurin B-like protein 2 Acts as a calcium sensor. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner. Binds two calcium ions per subunit. Mediates the activation of AKT1 by CIPK proteins (CIPK6, CIPK16, and CIPK23) in response to low potassium conditions and in the context of stomatal movement.probableQ8LAS7
Calcineurin B-like protein 3 Acts as a calcium sensor. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner.probableQ75LU8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZFD, chain A
Confidence level:very confident
Coverage over the Query: 32-177
View the alignment between query and template
View the model in PyMOL