Citrus Sinensis ID: 030405
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 178 | ||||||
| 147770306 | 226 | hypothetical protein VITISV_029390 [Viti | 0.966 | 0.761 | 0.924 | 6e-89 | |
| 166788449 | 226 | calcineurin B-like protein [Phaseolus vu | 0.966 | 0.761 | 0.918 | 1e-87 | |
| 449434060 | 226 | PREDICTED: calcineurin B-like protein 3- | 0.966 | 0.761 | 0.906 | 2e-87 | |
| 449491221 | 226 | PREDICTED: LOW QUALITY PROTEIN: calcineu | 0.966 | 0.761 | 0.901 | 3e-87 | |
| 356522091 | 226 | PREDICTED: calcineurin B-like protein 3- | 0.966 | 0.761 | 0.912 | 5e-87 | |
| 363807678 | 226 | uncharacterized protein LOC100791045 [Gl | 0.966 | 0.761 | 0.912 | 2e-86 | |
| 224089529 | 226 | predicted protein [Populus trichocarpa] | 0.966 | 0.761 | 0.901 | 4e-86 | |
| 255568116 | 224 | calcineurin B, putative [Ricinus communi | 0.955 | 0.758 | 0.918 | 4e-86 | |
| 115531880 | 226 | calcineurin B-like protein 3 [Populus eu | 0.966 | 0.761 | 0.895 | 2e-85 | |
| 388539505 | 226 | calcineurin B-like protein 2 [Lilium lon | 0.966 | 0.761 | 0.883 | 4e-84 |
| >gi|147770306|emb|CAN62487.1| hypothetical protein VITISV_029390 [Vitis vinifera] gi|229609883|gb|ACQ83557.1| calcineurin B-like protein 03 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 331 bits (849), Expect = 6e-89, Method: Compositional matrix adjust.
Identities = 159/172 (92%), Positives = 167/172 (97%)
Query: 1 MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSA 60
M+QCL+G+KH C VVVNCCDADLYKQP+GLEDPEALARETVFSVSEIEALYELFKKISSA
Sbjct: 1 MLQCLEGVKHLCAVVVNCCDADLYKQPKGLEDPEALARETVFSVSEIEALYELFKKISSA 60
Query: 61 VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILDFEEFARALSIFHPNSPI 120
VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILDFEEFARALS+FHPN+PI
Sbjct: 61 VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILDFEEFARALSVFHPNAPI 120
Query: 121 DDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKVL 172
+DKI+FSFQLYDLKQQGFIERQEVKQMVVATL ESGMNLSDDVIESIIDK
Sbjct: 121 EDKIDFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLSDDVIESIIDKTF 172
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|166788449|dbj|BAG06680.1| calcineurin B-like protein [Phaseolus vulgaris] | Back alignment and taxonomy information |
|---|
| >gi|449434060|ref|XP_004134814.1| PREDICTED: calcineurin B-like protein 3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449491221|ref|XP_004158833.1| PREDICTED: LOW QUALITY PROTEIN: calcineurin B-like protein 3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356522091|ref|XP_003529683.1| PREDICTED: calcineurin B-like protein 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|363807678|ref|NP_001241908.1| uncharacterized protein LOC100791045 [Glycine max] gi|255641958|gb|ACU21246.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224089529|ref|XP_002308747.1| predicted protein [Populus trichocarpa] gi|133925833|gb|ABO43669.1| calcineurin B-like protein 3 [Populus trichocarpa] gi|222854723|gb|EEE92270.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255568116|ref|XP_002525034.1| calcineurin B, putative [Ricinus communis] gi|223535696|gb|EEF37361.1| calcineurin B, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|115531880|gb|ABJ09706.1| calcineurin B-like protein 3 [Populus euphratica] | Back alignment and taxonomy information |
|---|
| >gi|388539505|gb|AFK64728.1| calcineurin B-like protein 2 [Lilium longiflorum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 178 | ||||||
| UNIPROTKB|Q8L7F6 | 225 | CnB "Calcineurin B-like protei | 0.949 | 0.751 | 0.888 | 1e-75 | |
| TAIR|locus:2161760 | 226 | CBL2 "AT5G55990" [Arabidopsis | 0.955 | 0.752 | 0.864 | 3.1e-74 | |
| TAIR|locus:2130499 | 226 | CBL6 "calcineurin B-like prote | 0.915 | 0.721 | 0.688 | 2.8e-57 | |
| TAIR|locus:2129306 | 213 | CBL1 "calcineurin B-like prote | 0.870 | 0.727 | 0.6 | 1.8e-48 | |
| TAIR|locus:2169794 | 222 | SOS3 "SALT OVERLY SENSITIVE 3" | 0.814 | 0.653 | 0.606 | 5.4e-47 | |
| TAIR|locus:2152012 | 213 | CBL9 "calcineurin B-like prote | 0.786 | 0.657 | 0.65 | 6.9e-47 | |
| TAIR|locus:2123767 | 256 | CBL10 "AT4G33000" [Arabidopsis | 0.797 | 0.554 | 0.619 | 7.3e-43 | |
| TAIR|locus:2019439 | 214 | CBL8 "calcineurin B-like prote | 0.882 | 0.733 | 0.528 | 1.6e-40 | |
| TAIR|locus:2133857 | 214 | CBL7 "calcineurin B-like prote | 0.691 | 0.574 | 0.632 | 3.3e-40 | |
| TAIR|locus:2125162 | 203 | CBL5 "calcineurin B-like prote | 0.859 | 0.753 | 0.461 | 1.1e-32 |
| UNIPROTKB|Q8L7F6 CnB "Calcineurin B-like protein" [Pisum sativum (taxid:3888)] | Back alignment and assigned GO terms |
|---|
Score = 763 (273.6 bits), Expect = 1.0e-75, P = 1.0e-75
Identities = 151/170 (88%), Positives = 157/170 (92%)
Query: 1 MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSA 60
M+QCL+G K V+ CCD D+ QPRGLEDPE LARETVFSVSEIEALYELFKKISSA
Sbjct: 1 MLQCLEGFKSLLASVLRCCDIDI-NQPRGLEDPELLARETVFSVSEIEALYELFKKISSA 59
Query: 61 VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILDFEEFARALSIFHPNSPI 120
VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGIL FEEFARALS+FHPN+PI
Sbjct: 60 VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPI 119
Query: 121 DDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDK 170
DDKIEFSFQLYDLKQQGFIERQEVKQMVVATL ESGMNLSDDVIESIIDK
Sbjct: 120 DDKIEFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLSDDVIESIIDK 169
|
|
| TAIR|locus:2161760 CBL2 "AT5G55990" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130499 CBL6 "calcineurin B-like protein 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129306 CBL1 "calcineurin B-like protein 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2169794 SOS3 "SALT OVERLY SENSITIVE 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152012 CBL9 "calcineurin B-like protein 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2123767 CBL10 "AT4G33000" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2019439 CBL8 "calcineurin B-like protein 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133857 CBL7 "calcineurin B-like protein 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2125162 CBL5 "calcineurin B-like protein 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 178 | |||
| COG5126 | 160 | COG5126, FRQ1, Ca2+-binding protein (EF-Hand super | 7e-11 | |
| pfam13833 | 53 | pfam13833, EF_hand_6, EF-hand domain pair | 3e-05 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 3e-04 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 6e-04 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 9e-04 | |
| cd00213 | 88 | cd00213, S-100, S-100: S-100 domain, which represe | 0.001 |
| >gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
Score = 57.3 bits (139), Expect = 7e-11
Identities = 33/132 (25%), Positives = 63/132 (47%), Gaps = 10/132 (7%)
Query: 40 TVFSVSEIEALYELFKKISSAVIDDGLINKEEFQ--LALFKTNKKESLFADRVFDLFDTK 97
T + +I+ L E F+ DGLI++ E L N E+ +++F+ D
Sbjct: 12 TQLTEEQIQELKEAFQLF--DRDSDGLIDRNELGKILRSLGFNPSEA-EINKLFEEIDAG 68
Query: 98 HNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGM 157
N +DF EF +S+ ++++ +F+L+D G+I E++++ L G
Sbjct: 69 -NETVDFPEFLTVMSVKLKRGDKEEELREAFKLFDKDHDGYISIGELRRV----LKSLGE 123
Query: 158 NLSDDVIESIID 169
LSD+ +E ++
Sbjct: 124 RLSDEEVEKLLK 135
|
Length = 160 |
| >gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|238131 cd00213, S-100, S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 178 | |||
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 99.89 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 99.88 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 99.86 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 99.79 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 99.76 | |
| PTZ00183 | 158 | centrin; Provisional | 99.73 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 99.73 | |
| PTZ00184 | 149 | calmodulin; Provisional | 99.72 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 99.62 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 99.55 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 99.51 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 99.49 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 99.48 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 99.44 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 99.42 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 99.41 | |
| PTZ00183 | 158 | centrin; Provisional | 99.4 | |
| PTZ00184 | 149 | calmodulin; Provisional | 99.36 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 99.18 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 99.11 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 99.1 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 99.06 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 98.9 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 98.9 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 98.89 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 98.87 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 98.84 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 98.82 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 98.79 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 98.77 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 98.75 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 98.74 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 98.72 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 98.72 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 98.72 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 98.72 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 98.71 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 98.67 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 98.66 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 98.66 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 98.65 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 98.65 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 98.64 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 98.63 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 98.61 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 98.61 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 98.58 | |
| KOG0040 | 2399 | consensus Ca2+-binding actin-bundling protein (spe | 98.57 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 98.57 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 98.56 | |
| KOG2562 | 493 | consensus Protein phosphatase 2 regulatory subunit | 98.53 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 98.5 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 98.5 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 98.47 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 98.46 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 98.46 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 98.44 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 98.44 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 98.43 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 98.41 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 98.4 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 98.39 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 98.36 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 98.31 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 98.26 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 98.18 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 98.16 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 98.05 | |
| KOG2643 | 489 | consensus Ca2+ binding protein, contains EF-hand m | 98.05 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 98.02 | |
| KOG0751 | 694 | consensus Mitochondrial aspartate/glutamate carrie | 97.98 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 97.97 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 97.86 | |
| KOG4251 | 362 | consensus Calcium binding protein [General functio | 97.86 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 97.84 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 97.75 | |
| KOG0751 | 694 | consensus Mitochondrial aspartate/glutamate carrie | 97.64 | |
| KOG4347 | 671 | consensus GTPase-activating protein VRP [General f | 97.59 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 97.49 | |
| KOG2643 | 489 | consensus Ca2+ binding protein, contains EF-hand m | 97.48 | |
| KOG4666 | 412 | consensus Predicted phosphate acyltransferase, con | 97.45 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 97.44 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 97.41 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 97.4 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 97.39 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 97.34 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 97.32 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 97.26 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 97.25 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 97.23 | |
| KOG0040 | 2399 | consensus Ca2+-binding actin-bundling protein (spe | 97.14 | |
| KOG4666 | 412 | consensus Predicted phosphate acyltransferase, con | 96.97 | |
| KOG4251 | 362 | consensus Calcium binding protein [General functio | 96.8 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 96.8 | |
| KOG0169 | 746 | consensus Phosphoinositide-specific phospholipase | 96.69 | |
| KOG3555 | 434 | consensus Ca2+-binding proteoglycan Testican [Gene | 96.38 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 96.14 | |
| KOG4065 | 144 | consensus Uncharacterized conserved protein [Funct | 96.14 | |
| KOG2562 | 493 | consensus Protein phosphatase 2 regulatory subunit | 95.77 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 95.75 | |
| KOG4578 | 421 | consensus Uncharacterized conserved protein, conta | 95.43 | |
| KOG0035 | 890 | consensus Ca2+-binding actin-bundling protein (act | 95.37 | |
| PF09068 | 127 | EF-hand_2: EF hand; InterPro: IPR015153 Like other | 95.32 | |
| PF08414 | 100 | NADPH_Ox: Respiratory burst NADPH oxidase; InterPr | 94.54 | |
| KOG1955 | 737 | consensus Ral-GTPase effector RALBP1 [Intracellula | 94.49 | |
| PF05042 | 174 | Caleosin: Caleosin related protein; InterPro: IPR0 | 94.2 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 93.1 | |
| KOG1955 | 737 | consensus Ral-GTPase effector RALBP1 [Intracellula | 92.86 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 92.8 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 92.18 | |
| PF05517 | 154 | p25-alpha: p25-alpha ; InterPro: IPR008907 This fa | 91.56 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 91.42 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 91.33 | |
| PF08726 | 69 | EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr | 90.82 | |
| KOG0039 | 646 | consensus Ferric reductase, NADH/NADPH oxidase and | 90.72 | |
| KOG4578 | 421 | consensus Uncharacterized conserved protein, conta | 90.61 | |
| KOG4065 | 144 | consensus Uncharacterized conserved protein [Funct | 90.55 | |
| PF09069 | 90 | EF-hand_3: EF-hand; InterPro: IPR015154 Like other | 89.95 | |
| KOG1707 | 625 | consensus Predicted Ras related/Rac-GTP binding pr | 89.38 | |
| KOG2557 | 427 | consensus Uncharacterized conserved protein, conta | 88.94 | |
| PF11829 | 96 | DUF3349: Protein of unknown function (DUF3349); In | 88.86 | |
| KOG3555 | 434 | consensus Ca2+-binding proteoglycan Testican [Gene | 88.71 | |
| KOG3866 | 442 | consensus DNA-binding protein of the nucleobindin | 88.7 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 88.26 | |
| PF14513 | 138 | DAG_kinase_N: Diacylglycerol kinase N-terminus; PD | 86.66 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 86.2 | |
| KOG4286 | 966 | consensus Dystrophin-like protein [Cell motility; | 85.28 | |
| KOG0169 | 746 | consensus Phosphoinositide-specific phospholipase | 84.45 | |
| PF05517 | 154 | p25-alpha: p25-alpha ; InterPro: IPR008907 This fa | 83.95 | |
| PF05042 | 174 | Caleosin: Caleosin related protein; InterPro: IPR0 | 80.59 |
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
Probab=99.89 E-value=9.5e-22 Score=137.13 Aligned_cols=131 Identities=24% Similarity=0.421 Sum_probs=118.5
Q ss_pred HHhhcCCCHHHHHHHHHHHHhhcccCCCCCcccHHHHHHHHhcCC-CCCHHHHHHHHHHHhcCCCCcccHHHHHHHHHhh
Q 030405 36 LARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTN-KKESLFADRVFDLFDTKHNGILDFEEFARALSIF 114 (178)
Q Consensus 36 ~~~~~~~~~~~i~~l~~~F~~~d~~~~~~g~i~~~ef~~~l~~~~-~~~~~~~~~lf~~~d~~~~g~i~~~ef~~~~~~~ 114 (178)
+...+.|+.+++++|+++|..+|++ ++|.|++.+|..++...+ ...+..+.++|..++. +.+.|+|.+|+.++...
T Consensus 8 ~~~~~~~t~~qi~~lkeaF~l~D~d--~~G~I~~~el~~ilr~lg~~~s~~ei~~l~~~~d~-~~~~idf~~Fl~~ms~~ 84 (160)
T COG5126 8 LLTFTQLTEEQIQELKEAFQLFDRD--SDGLIDRNELGKILRSLGFNPSEAEINKLFEEIDA-GNETVDFPEFLTVMSVK 84 (160)
T ss_pred hhhcccCCHHHHHHHHHHHHHhCcC--CCCCCcHHHHHHHHHHcCCCCcHHHHHHHHHhccC-CCCccCHHHHHHHHHHH
Confidence 5666789999999999999999999 999999999999997744 4557788999999999 88999999999999998
Q ss_pred CCCCChhHHHHHHHHhhCCCCCCceeHHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHh
Q 030405 115 HPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKVLS 173 (178)
Q Consensus 115 ~~~~~~~e~~~~~F~~~D~d~~G~I~~~e~~~~l~~~~~~~~~~l~~~~~~~~~~~~~~ 173 (178)
......+++++++|+.||.|++|+|+..|++++++.+ |..++++++++++..+-.
T Consensus 85 ~~~~~~~Eel~~aF~~fD~d~dG~Is~~eL~~vl~~l----ge~~~deev~~ll~~~d~ 139 (160)
T COG5126 85 LKRGDKEEELREAFKLFDKDHDGYISIGELRRVLKSL----GERLSDEEVEKLLKEYDE 139 (160)
T ss_pred hccCCcHHHHHHHHHHhCCCCCceecHHHHHHHHHhh----cccCCHHHHHHHHHhcCC
Confidence 8768889999999999999999999999999999877 999999999988876543
|
|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >KOG4251 consensus Calcium binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG4347 consensus GTPase-activating protein VRP [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4251 consensus Calcium binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only] | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >KOG4065 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0035 consensus Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09068 EF-hand_2: EF hand; InterPro: IPR015153 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions | Back alignment and domain information |
|---|
| >PF08414 NADPH_Ox: Respiratory burst NADPH oxidase; InterPro: IPR013623 This domain is found in plant proteins such as respiratory burst NADPH oxidase proteins which produce reactive oxygen species as a defence mechanism | Back alignment and domain information |
|---|
| >KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes | Back alignment and domain information |
|---|
| >KOG0039 consensus Ferric reductase, NADH/NADPH oxidase and related proteins [Inorganic ion transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4065 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions | Back alignment and domain information |
|---|
| >KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG2557 consensus Uncharacterized conserved protein, contains TLDc domain [Function unknown] | Back alignment and domain information |
|---|
| >PF11829 DUF3349: Protein of unknown function (DUF3349); InterPro: IPR021784 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >PF14513 DAG_kinase_N: Diacylglycerol kinase N-terminus; PDB: 1TUZ_A | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG4286 consensus Dystrophin-like protein [Cell motility; Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] | Back alignment and domain information |
|---|
| >PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 178 | ||||
| 2zfd_A | 226 | The Crystal Structure Of Plant Specific Calcium Bin | 3e-82 | ||
| 1uhn_A | 189 | The Crystal Structure Of The Calcium Binding Protei | 4e-70 | ||
| 2ehb_A | 207 | The Structure Of The C-Terminal Domain Of The Prote | 9e-51 | ||
| 1v1f_A | 222 | Structure Of The Arabidopsis Thaliana Sos3 Complexe | 1e-50 | ||
| 1s1e_A | 224 | Crystal Structure Of Kv Channel-Interacting Protein | 2e-12 | ||
| 1s6c_A | 183 | Crystal Structure Of The Complex Between Kchip1 And | 2e-12 | ||
| 2l2e_A | 190 | Solution Nmr Structure Of Myristoylated Ncs1p In Ap | 1e-11 | ||
| 3dd4_A | 229 | Structural Basis Of Kchip4a Modulation Of Kv4.3 Slo | 4e-11 | ||
| 2nz0_A | 180 | Crystal Structure Of Potassium Channel Kv4.3 In Com | 5e-11 | ||
| 2i2r_E | 180 | Crystal Structure Of The Kchip1KV4.3 T1 COMPLEX Len | 5e-11 | ||
| 1tco_B | 169 | Ternary Complex Of A Calcineurin A Fragment, Calcin | 9e-11 | ||
| 1mf8_B | 170 | Crystal Structure Of Human Calcineurin Complexed Wi | 9e-11 | ||
| 1g8i_A | 190 | Crystal Structure Of Human Frequenin (Neuronal Calc | 2e-10 | ||
| 3ll8_B | 155 | Crystal Structure Of Calcineurin In Complex With Ak | 4e-10 | ||
| 2p6b_B | 156 | Crystal Structure Of Human Calcineurin In Complex W | 4e-10 | ||
| 2jul_A | 256 | Nmr Structure Of Dream Length = 256 | 2e-09 | ||
| 2ct9_A | 208 | The Crystal Structure Of Calcineurin B Homologous P | 4e-09 | ||
| 2e30_A | 195 | Solution Structure Of The Cytoplasmic Region Of Na+ | 8e-09 | ||
| 2het_A | 189 | Non-Myristoylated Bovine Recoverin (Truncated At C- | 5e-08 | ||
| 2i94_A | 202 | Nmr Structure Of Recoverin Bound To Rhodopsin Kinas | 5e-08 | ||
| 1omr_A | 201 | Non-Myristoylated Wild-Type Bovine Recoverin With C | 5e-08 | ||
| 1jsa_A | 201 | Myristoylated Recoverin With Two Calciums Bound, Nm | 5e-08 | ||
| 1bjf_A | 193 | Crystal Structure Of Recombinant Bovine Neurocalcin | 6e-08 | ||
| 1omv_A | 201 | Non-Myristoylated Bovine Recoverin (E85q Mutant) Wi | 1e-07 | ||
| 1la3_A | 201 | Solution Structure Of Recoverin Mutant, E85q Length | 1e-07 | ||
| 2d8n_A | 207 | Crystal Structure Of Human Recoverin At 2.2 A Resol | 3e-07 | ||
| 1fpw_A | 190 | Structure Of Yeast Frequenin Length = 190 | 2e-06 | ||
| 2ggz_A | 211 | Crystal Structure Of Human Guanylate Cyclase Activa | 5e-06 | ||
| 2bec_A | 202 | Crystal Structure Of Chp2 In Complex With Its Bindi | 6e-06 | ||
| 2r2i_A | 198 | Myristoylated Guanylate Cyclase Activating Protein- | 6e-05 | ||
| 1jba_A | 204 | Unmyristoylated Gcap-2 With Three Calcium Ions Boun | 4e-04 |
| >pdb|2ZFD|A Chain A, The Crystal Structure Of Plant Specific Calcium Binding Protein Atcbl2 In Complex With The Regulatory Domain Of Atcipk14 Length = 226 | Back alignment and structure |
|
| >pdb|1UHN|A Chain A, The Crystal Structure Of The Calcium Binding Protein Atcbl2 From Arabidopsis Thaliana Length = 189 | Back alignment and structure |
| >pdb|2EHB|A Chain A, The Structure Of The C-Terminal Domain Of The Protein Kinase Atsos2 Bound To The Calcium Sensor Atsos3 Length = 207 | Back alignment and structure |
| >pdb|1V1F|A Chain A, Structure Of The Arabidopsis Thaliana Sos3 Complexed With Calcium(Ii) And Manganese(Ii) Ions Length = 222 | Back alignment and structure |
| >pdb|1S1E|A Chain A, Crystal Structure Of Kv Channel-Interacting Protein 1 (Kchip-1) Length = 224 | Back alignment and structure |
| >pdb|1S6C|A Chain A, Crystal Structure Of The Complex Between Kchip1 And Kv4.2 N1-30 Length = 183 | Back alignment and structure |
| >pdb|2L2E|A Chain A, Solution Nmr Structure Of Myristoylated Ncs1p In Apo Form Length = 190 | Back alignment and structure |
| >pdb|3DD4|A Chain A, Structural Basis Of Kchip4a Modulation Of Kv4.3 Slow Inactivation Length = 229 | Back alignment and structure |
| >pdb|2NZ0|A Chain A, Crystal Structure Of Potassium Channel Kv4.3 In Complex With Its Regulatory Subunit Kchip1 (Casp Target) Length = 180 | Back alignment and structure |
| >pdb|2I2R|E Chain E, Crystal Structure Of The Kchip1KV4.3 T1 COMPLEX Length = 180 | Back alignment and structure |
| >pdb|1TCO|B Chain B, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 169 | Back alignment and structure |
| >pdb|1MF8|B Chain B, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 170 | Back alignment and structure |
| >pdb|1G8I|A Chain A, Crystal Structure Of Human Frequenin (Neuronal Calcium Sensor 1) Length = 190 | Back alignment and structure |
| >pdb|3LL8|B Chain B, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 155 | Back alignment and structure |
| >pdb|2P6B|B Chain B, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 156 | Back alignment and structure |
| >pdb|2JUL|A Chain A, Nmr Structure Of Dream Length = 256 | Back alignment and structure |
| >pdb|2CT9|A Chain A, The Crystal Structure Of Calcineurin B Homologous Proein 1 (Chp1) Length = 208 | Back alignment and structure |
| >pdb|2E30|A Chain A, Solution Structure Of The Cytoplasmic Region Of Na+H+ Exchanger 1 Complexed With Essential Cofactor Calcineurin B Homologous Protein 1 Length = 195 | Back alignment and structure |
| >pdb|2HET|A Chain A, Non-Myristoylated Bovine Recoverin (Truncated At C-Terminus) With Calcium Bound To Ef-Hand 3 Length = 189 | Back alignment and structure |
| >pdb|2I94|A Chain A, Nmr Structure Of Recoverin Bound To Rhodopsin Kinase Length = 202 | Back alignment and structure |
| >pdb|1OMR|A Chain A, Non-Myristoylated Wild-Type Bovine Recoverin With Calcium Bound To Ef- Hand 3 Length = 201 | Back alignment and structure |
| >pdb|1JSA|A Chain A, Myristoylated Recoverin With Two Calciums Bound, Nmr, 24 Structures Length = 201 | Back alignment and structure |
| >pdb|1BJF|A Chain A, Crystal Structure Of Recombinant Bovine Neurocalcin Delta At 2.4 Angstroms Length = 193 | Back alignment and structure |
| >pdb|1OMV|A Chain A, Non-Myristoylated Bovine Recoverin (E85q Mutant) With Calcium Bound To Ef-Hand 3 Length = 201 | Back alignment and structure |
| >pdb|1LA3|A Chain A, Solution Structure Of Recoverin Mutant, E85q Length = 201 | Back alignment and structure |
| >pdb|2D8N|A Chain A, Crystal Structure Of Human Recoverin At 2.2 A Resolution Length = 207 | Back alignment and structure |
| >pdb|1FPW|A Chain A, Structure Of Yeast Frequenin Length = 190 | Back alignment and structure |
| >pdb|2GGZ|A Chain A, Crystal Structure Of Human Guanylate Cyclase Activating Protein-3 Length = 211 | Back alignment and structure |
| >pdb|2BEC|A Chain A, Crystal Structure Of Chp2 In Complex With Its Binding Region In Nhe1 And Insights Into The Mechanism Of Ph Regulation Length = 202 | Back alignment and structure |
| >pdb|2R2I|A Chain A, Myristoylated Guanylate Cyclase Activating Protein-1 With Calcium Bound Length = 198 | Back alignment and structure |
| >pdb|1JBA|A Chain A, Unmyristoylated Gcap-2 With Three Calcium Ions Bound Length = 204 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 178 | |||
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 3e-65 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 2e-52 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 2e-38 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 2e-37 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 3e-37 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 4e-37 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 1e-35 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 8e-35 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 1e-34 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 3e-34 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 6e-34 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 1e-33 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 2e-33 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 3e-33 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 6e-33 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 1e-32 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 2e-32 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 3e-30 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 9e-30 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 2e-12 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 2e-12 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 3e-12 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 6e-12 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 9e-12 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 2e-11 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 2e-11 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 2e-11 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 8e-11 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 2e-10 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 4e-10 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 2e-09 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 2e-09 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 3e-09 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 4e-09 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 5e-09 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 5e-09 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 4e-08 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 7e-09 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 9e-05 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 3e-08 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 1e-07 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 1e-05 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 8e-04 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 2e-07 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 2e-07 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 6e-04 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 2e-07 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 4e-07 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 5e-07 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 5e-07 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 5e-07 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 8e-07 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 9e-07 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 1e-06 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 2e-06 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 2e-06 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 2e-06 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 3e-06 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 3e-06 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 4e-06 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 7e-05 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 6e-06 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 6e-06 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 6e-06 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 6e-06 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 8e-06 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 8e-04 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 8e-06 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 9e-06 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 6e-05 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 1e-05 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 1e-05 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 5e-04 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 2e-05 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 2e-05 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 2e-05 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 2e-05 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 2e-05 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 3e-05 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 5e-05 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 5e-05 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 8e-05 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 8e-05 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 8e-05 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 4e-04 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 8e-05 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 8e-05 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 8e-05 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 1e-04 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 1e-04 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 1e-04 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 1e-04 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 1e-04 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 2e-04 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 2e-04 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 2e-04 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 2e-04 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 2e-04 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 2e-04 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 2e-04 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 2e-04 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 2e-04 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 2e-04 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 3e-04 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 3e-04 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 3e-04 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 3e-04 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 4e-04 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 4e-04 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 4e-04 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 5e-04 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 5e-04 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 6e-04 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 6e-04 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 7e-04 |
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 | Back alignment and structure |
|---|
Score = 198 bits (506), Expect = 3e-65
Identities = 147/173 (84%), Positives = 153/173 (88%)
Query: 1 MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSA 60
M QC+DG+KH C V+ C D DLYKQ GL DPE LAR+TVFSVSEIEALYELFKKISSA
Sbjct: 1 MSQCVDGIKHLCTSVLGCFDLDLYKQSGGLGDPELLARDTVFSVSEIEALYELFKKISSA 60
Query: 61 VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILDFEEFARALSIFHPNSPI 120
VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGIL FEEFARALS+FHPN+PI
Sbjct: 61 VIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPI 120
Query: 121 DDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKVLS 173
DDKI FSFQLYDLKQQGFIERQEVKQMVVATL ESGMNL D VIE IIDK
Sbjct: 121 DDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKTFE 173
|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179 | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Length = 261 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Length = 78 | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Length = 96 | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Length = 99 | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Length = 113 | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Length = 93 | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Length = 95 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Length = 101 | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Length = 93 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Length = 113 | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Length = 93 | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Length = 99 | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Length = 95 | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Length = 92 | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Length = 92 | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Length = 90 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 178 | |||
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 99.95 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 99.9 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 99.87 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 99.87 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 99.85 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 99.84 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 99.83 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 99.83 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 99.82 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 99.82 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 99.82 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 99.81 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 99.81 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 99.81 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 99.81 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 99.81 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 99.81 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 99.81 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 99.8 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 99.8 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 99.8 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 99.79 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 99.79 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 99.79 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 99.79 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 99.79 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.78 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 99.78 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 99.77 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.77 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 99.77 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 99.76 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 99.76 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 99.76 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 99.76 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 99.75 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 99.75 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.75 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 99.74 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 99.74 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 99.74 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 99.73 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.73 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 99.73 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 99.72 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 99.72 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 99.72 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 99.71 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 99.71 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 99.7 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 99.7 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 99.7 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 99.7 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.69 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 99.69 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 99.69 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 99.68 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 99.68 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 99.68 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 99.68 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 99.68 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 99.67 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 99.67 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 99.67 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 99.67 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 99.67 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 99.67 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 99.67 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 99.67 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 99.66 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 99.65 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 99.65 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 99.64 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 99.64 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 99.64 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 99.62 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 99.62 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 99.62 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 99.62 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 99.61 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 99.6 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.6 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.59 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.59 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 99.59 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.58 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 99.58 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 99.57 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 99.57 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 99.57 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 99.57 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 99.56 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 99.56 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 99.55 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 99.55 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 99.55 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 99.54 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 99.54 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 99.54 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 99.54 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 99.54 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 99.54 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 99.54 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 99.54 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 99.53 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 99.53 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 99.53 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 99.53 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 99.52 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 99.52 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 99.52 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 99.52 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 99.52 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 99.51 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 99.51 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 99.51 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 99.51 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 99.51 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 99.51 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 99.51 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 99.5 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 99.5 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 99.5 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 99.5 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 99.5 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 99.49 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 99.49 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 99.49 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 99.48 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 99.48 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 99.48 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 99.48 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 99.47 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.47 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 99.47 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 99.45 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.45 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 99.45 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 99.45 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.45 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 99.44 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 99.44 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 99.44 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 99.43 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 99.43 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 99.43 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.42 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 99.41 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 99.41 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 99.41 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 99.4 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 99.4 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.4 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 99.4 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 99.4 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 99.39 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.39 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 99.38 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 99.38 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 99.38 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 99.38 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.38 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.38 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 99.37 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 99.37 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 99.37 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 99.36 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 99.36 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 99.36 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 99.35 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.35 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 99.35 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 99.34 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 99.34 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 99.33 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 99.32 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 99.32 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 99.32 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 99.31 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 99.3 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 99.3 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 99.29 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 99.26 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 99.25 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 99.24 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 99.24 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 99.23 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 99.23 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 99.22 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.2 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 99.2 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 99.19 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 99.19 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 99.18 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 99.17 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 99.17 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 99.17 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 99.17 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 99.15 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 99.14 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 99.13 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 99.13 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 99.11 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 99.1 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 99.09 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 99.09 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.08 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 99.08 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 99.05 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 99.05 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 99.04 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 99.04 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 99.03 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 99.02 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 99.02 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 99.02 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 99.02 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 99.01 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 99.01 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 99.0 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 99.0 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 99.0 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 99.0 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 98.99 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 98.99 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 98.98 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 98.98 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 98.98 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 98.97 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 98.97 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 98.96 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 98.96 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 98.95 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 98.95 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 98.94 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 98.94 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 98.94 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 98.92 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 98.92 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 98.91 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 98.91 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 98.91 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 98.9 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 98.9 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 98.89 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 98.89 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 98.89 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 98.89 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 98.89 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 98.88 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 98.88 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 98.87 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 98.86 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 98.85 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 98.85 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 98.85 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 98.84 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 98.84 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 98.83 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 98.83 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 98.83 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 98.83 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 98.83 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 98.82 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 98.82 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 98.82 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 98.81 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 98.81 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 98.81 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 98.8 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 98.8 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 98.79 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 98.79 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 98.78 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 98.78 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 98.77 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 98.77 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 98.77 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 98.77 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 98.77 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 98.77 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 98.76 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 98.76 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 98.75 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 98.75 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 98.74 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 98.74 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 98.73 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 98.73 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 98.73 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.73 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 98.72 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 98.69 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 98.67 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 98.67 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 98.66 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 98.64 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 98.64 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 98.63 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 98.62 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 98.58 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 98.56 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 98.49 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 98.47 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 98.46 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 98.44 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 98.35 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 98.29 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 98.19 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 98.17 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 98.13 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 98.08 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 97.99 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 97.82 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 97.52 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 97.21 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 96.1 | |
| 1pul_A | 125 | Hypothetical protein C32E8.3 in chromosome I; alph | 95.44 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 94.79 | |
| 1pul_A | 125 | Hypothetical protein C32E8.3 in chromosome I; alph | 94.36 | |
| 2l5y_A | 150 | Stromal interaction molecule 2; EF-hand, SAM domai | 94.05 | |
| 2kav_A | 129 | Sodium channel protein type 2 subunit alpha; volta | 93.35 | |
| 1wlm_A | 151 | Protein CGI-38; structural genomics, NPPSFA, natio | 93.0 | |
| 4fl4_A | 88 | Glycoside hydrolase family 9; structural genomics, | 92.06 | |
| 2kav_A | 129 | Sodium channel protein type 2 subunit alpha; volta | 91.32 | |
| 4dh2_B | 82 | Dockerin type 1; cellulosome, cohesin, type I cohe | 89.6 | |
| 3ul4_B | 65 | Cellulosome enzyme, dockerin type I; cohesin, type | 89.41 | |
| 2k60_A | 150 | Protein (stromal interaction molecule 1); EF-hand, | 89.33 | |
| 2jrf_A | 184 | Tubulin polymerization-promoting protein family me | 89.3 | |
| 2jrf_A | 184 | Tubulin polymerization-promoting protein family me | 88.49 | |
| 4dck_A | 168 | Sodium channel protein type 5 subunit alpha; IQ-mo | 87.85 | |
| 3ol3_A | 107 | Putative uncharacterized protein; tuberculosis, RV | 87.29 | |
| 4dck_A | 168 | Sodium channel protein type 5 subunit alpha; IQ-mo | 86.55 | |
| 2ccl_B | 63 | Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d | 86.3 | |
| 2lky_A | 112 | Uncharacterized protein; infectious disease, tuber | 86.2 | |
| 2vn6_B | 64 | Endoglucanase A; cell adhesion, carbohydrate metab | 85.0 | |
| 1wlm_A | 151 | Protein CGI-38; structural genomics, NPPSFA, natio | 83.86 | |
| 3te3_A | 39 | Polycystic kidney disease 2-like 1 protein; trimer | 83.6 | |
| 2y3n_B | 71 | Cellulosomal family-48 processive glycoside hydro; | 83.07 | |
| 2kvc_A | 103 | Putative uncharacterized protein; structural genom | 82.41 | |
| 2l5y_A | 150 | Stromal interaction molecule 2; EF-hand, SAM domai | 81.95 |
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
Probab=99.95 E-value=4.2e-26 Score=169.25 Aligned_cols=177 Identities=83% Similarity=1.223 Sum_probs=129.0
Q ss_pred CcccccccchhhhhhhcccCccccCCCCCCCcHHHHHhhcCCCHHHHHHHHHHHHhhcccCCCCCcccHHHHHHHHhcCC
Q 030405 1 MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEALARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTN 80 (178)
Q Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~l~~~F~~~d~~~~~~g~i~~~ef~~~l~~~~ 80 (178)
|.||+.|+..+..+.||+..+.++++++....+..+...++++..+++.++..|..+|.+..++|.|+..+|..++....
T Consensus 1 ~~~~~~~~~~~~~~~MG~~~s~~~~~~l~~~~~~~l~~~~~ls~~ei~~l~~~F~~~D~d~~~~G~I~~~El~~~l~~~~ 80 (226)
T 2zfd_A 1 MSQCVDGIKHLCTSVLGCFDLDLYKQSGGLGDPELLARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTN 80 (226)
T ss_dssp -------------------------------CTHHHHHHSSCCHHHHHHHHHHHHHHHTSSSCSSSBCHHHHHHHHHSCS
T ss_pred CchhhhhHHHHHHHhhccchhhhccccCCHHHHHHHHHhCCCCHHHHHHHHHHHHHhCcccCCCCeEcHHHHHHHHhccC
Confidence 78999999999999999999998887888899999999999999999999999999986422689999999999987744
Q ss_pred CCCHHHHHHHHHHHhcCCCCcccHHHHHHHHHhhCCCCChhHHHHHHHHhhCCCCCCceeHHHHHHHHHHHHhhcCCCCC
Q 030405 81 KKESLFADRVFDLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLS 160 (178)
Q Consensus 81 ~~~~~~~~~lf~~~d~~~~g~i~~~ef~~~~~~~~~~~~~~e~~~~~F~~~D~d~~G~I~~~e~~~~l~~~~~~~~~~l~ 160 (178)
...+..++.+|+.+|.+++|.|+|+||..++..........+.++.+|+.||.|++|.|+.+||..++..++...|.+++
T Consensus 81 ~~~~~~~~~~f~~~D~d~dG~I~~~Ef~~~~~~~~~~~~~~~~l~~~F~~~D~d~~G~Is~~E~~~~l~~~~~~~g~~~~ 160 (226)
T 2zfd_A 81 KKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLK 160 (226)
T ss_dssp SCCCHHHHHHHHHHCSSCSSSBCHHHHHHHHHHTSTTSCHHHHHHHHHHHHCTTSSSSEEHHHHHHHHHHHHHHTTCCCC
T ss_pred cccHHHHHHHHHHHcCCCCCcCcHHHHHHHHHHHccCCCHHHHHHHHHHHhCCCCCCcccHHHHHHHHHHHHHHcCCCCC
Confidence 44556678899999999999999999999998876545677889999999999999999999999999877666788999
Q ss_pred HHHHHHHHHHHHhhccC
Q 030405 161 DDVIESIIDKVLSLIQL 177 (178)
Q Consensus 161 ~~~~~~~~~~~~~~~D~ 177 (178)
+++++.+++.+|..+|.
T Consensus 161 ~~~~~~~~~~~f~~~D~ 177 (226)
T 2zfd_A 161 DTVIEDIIDKTFEEADT 177 (226)
T ss_dssp HHHHHHHHHHHHHHHCS
T ss_pred HHHHHHHHHHHHHHhCC
Confidence 99999999999998874
|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A | Back alignment and structure |
|---|
| >2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3ul4_B Cellulosome enzyme, dockerin type I; cohesin, type I cohesin-dockerin COMP protein-protein interaction, cell adhesion; HET: PEG; 1.95A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >3ol3_A Putative uncharacterized protein; tuberculosis, RV0543C, ortholog, iodide ION S phasing, structural genomics; HET: PG4 PGE; 1.95A {Mycobacterium smegmatis} PDB: 3ol4_A | Back alignment and structure |
|---|
| >4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B | Back alignment and structure |
|---|
| >2lky_A Uncharacterized protein; infectious disease, tuberculosis, DUF proteins, ssgcid, STRU genomics; NMR {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >2vn6_B Endoglucanase A; cell adhesion, carbohydrate metabolism, polysaccharide degradation, hydrolase, glycosidase, cellulose degradation; 1.49A {Clostridium cellulolyticum} PDB: 2vn5_B | Back alignment and structure |
|---|
| >1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >3te3_A Polycystic kidney disease 2-like 1 protein; trimeric coiled-coil, oligomerization domain, C-terminal CYT regulatory domain, metal transport; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2y3n_B Cellulosomal family-48 processive glycoside hydro; structrual protein-hydrolase complex, cellulosome; 1.90A {Bacteroides cellulosolvens} | Back alignment and structure |
|---|
| >2kvc_A Putative uncharacterized protein; structural genomics, seattle structural genomi for infectious disease, ssgcid, unknown function; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 178 | ||||
| d2zfda1 | 183 | a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { | 1e-28 | |
| d1fpwa_ | 190 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 1e-18 | |
| d1g8ia_ | 187 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 3e-18 | |
| d1xo5a_ | 180 | a.39.1.5 (A:) Calcium- and integrin-binding protei | 4e-18 | |
| d1s6ca_ | 178 | a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera | 1e-16 | |
| d1omra_ | 201 | a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: | 2e-16 | |
| d1tuza_ | 118 | a.39.1.7 (A:) Diacylglycerol kinase alpha, N-termi | 1e-15 | |
| d1bjfa_ | 181 | a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId | 2e-15 | |
| d1jbaa_ | 189 | a.39.1.5 (A:) Guanylate cyclase activating protein | 6e-15 | |
| d1juoa_ | 172 | a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: | 2e-08 | |
| d1k94a_ | 165 | a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta | 3e-08 | |
| d1lkja_ | 146 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 1e-06 | |
| d1qxpa2 | 188 | a.39.1.8 (A:515-702) Calpain large subunit, C-term | 2e-06 | |
| d1exra_ | 146 | a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr | 4e-06 | |
| d1auib_ | 165 | a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch | 1e-05 | |
| d1e8aa_ | 87 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 2e-05 | |
| d5pala_ | 109 | a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis | 2e-05 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 2e-05 | |
| d2zkmx1 | 170 | a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human | 5e-05 | |
| d1qlsa_ | 95 | a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), | 5e-05 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 6e-05 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 3e-04 | |
| d1rroa_ | 108 | a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) | 6e-05 | |
| d1pvaa_ | 109 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 8e-05 | |
| d3cr5x1 | 90 | a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos tauru | 9e-05 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 1e-04 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 0.003 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 1e-04 | |
| d1j55a_ | 94 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 2e-04 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 2e-04 | |
| d1a4pa_ | 92 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 3e-04 | |
| d2pvba_ | 107 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 4e-04 | |
| d1cb1a_ | 78 | a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax | 9e-04 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 0.001 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 0.002 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 0.001 | |
| d3c1va1 | 93 | a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa | 0.001 | |
| d1psra_ | 100 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 0.001 | |
| d1zfsa1 | 93 | a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no | 0.001 | |
| d1ksoa_ | 93 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 0.001 | |
| d1yuta1 | 98 | a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa | 0.002 | |
| d1xk4c1 | 83 | a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sa | 0.002 | |
| d1jfja_ | 134 | a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly | 0.002 | |
| d1c07a_ | 95 | a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: | 0.004 | |
| d2scpa_ | 174 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 0.004 | |
| d1avsa_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 0.004 |
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Calmodulin-like domain: Calcineurin B-like protein 2 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 102 bits (255), Expect = 1e-28
Identities = 129/141 (91%), Positives = 132/141 (93%)
Query: 32 DPEALARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVF 91
DPE LAR+TVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVF
Sbjct: 1 DPELLARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVF 60
Query: 92 DLFDTKHNGILDFEEFARALSIFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVAT 151
DLFDTKHNGIL FEEFARALS+FHPN+PIDDKI FSFQLYDLKQQGFIERQEVKQMVVAT
Sbjct: 61 DLFDTKHNGILGFEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVAT 120
Query: 152 LTESGMNLSDDVIESIIDKVL 172
L ESGMNL D VIE IIDK
Sbjct: 121 LAESGMNLKDTVIEDIIDKTF 141
|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Length = 95 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Length = 90 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 178 | |||
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 99.91 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 99.89 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 99.86 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 99.85 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 99.83 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 99.83 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 99.82 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 99.82 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 99.81 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.81 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 99.81 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 99.79 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 99.78 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 99.76 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 99.73 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.68 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 99.68 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.68 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 99.66 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 99.64 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 99.63 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.61 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 99.59 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 99.57 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 99.56 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 99.53 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 99.53 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 99.53 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 99.52 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.51 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 99.5 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 99.5 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 99.48 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 99.48 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 99.48 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 99.47 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 99.47 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 99.44 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 99.44 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 99.43 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 99.43 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 99.43 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 99.43 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 99.42 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.42 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 99.42 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.41 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 99.41 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.4 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 99.4 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 99.4 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 99.39 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 99.39 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 99.39 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.38 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 99.38 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 99.38 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 99.36 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 99.36 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 99.35 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 99.35 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 99.35 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 99.35 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 99.34 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 99.34 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.34 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 99.33 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 99.33 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 99.32 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 99.3 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.3 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 99.3 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.3 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 99.29 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 99.29 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.28 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 99.26 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.25 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 99.25 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 99.24 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 99.24 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 99.24 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.22 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 99.2 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 99.2 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 99.2 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 99.17 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 99.17 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.15 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.14 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 99.12 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.11 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 99.1 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 99.1 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 99.1 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.1 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.09 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 99.08 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 99.08 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.07 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 99.07 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 99.07 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 99.06 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.06 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.05 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.04 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 99.04 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.03 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 99.02 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 98.99 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 98.95 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 98.94 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 98.94 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 98.93 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 98.93 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 98.93 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 98.89 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 98.89 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 98.89 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 98.88 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 98.84 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 98.83 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 98.83 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 98.83 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 98.82 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 98.81 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 98.8 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 98.8 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 98.76 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.75 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 98.71 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 98.69 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 98.68 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 98.68 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 98.67 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 98.61 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 98.61 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.61 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 98.59 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 98.58 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 98.56 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 98.55 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.54 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 98.46 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 98.45 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 98.4 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 98.37 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 98.37 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 98.37 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.36 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 98.32 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.28 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 98.26 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 97.88 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 97.63 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 97.62 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 97.61 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 97.54 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 97.36 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 97.24 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 96.08 | |
| d1eg3a1 | 125 | Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | 95.83 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 95.27 | |
| d2cclb1 | 59 | Endo-1,4-beta-xylanase Y {Clostridium thermocellum | 95.05 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 93.2 | |
| d1pula1 | 103 | Hypothetical protein c32e8.3 {Caenorhabditis elega | 91.96 | |
| d1h8ba_ | 73 | alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} | 90.28 | |
| d1j7qa_ | 86 | Calcium vector protein {Amphioxus (Branchiostoma l | 90.06 | |
| d1dava_ | 71 | Cellulosome endoglucanase SS {Clostridium thermoce | 88.57 | |
| d1wlma1 | 138 | Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 | 85.7 | |
| d1wlma1 | 138 | Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 | 84.05 |
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Calmodulin-like domain: Calcineurin B-like protein 2 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.91 E-value=7.4e-23 Score=145.60 Aligned_cols=145 Identities=88% Similarity=1.237 Sum_probs=130.8
Q ss_pred HHHHHhhcCCCHHHHHHHHHHHHhhcccCCCCCcccHHHHHHHHhcCCCCCHHHHHHHHHHHhcCCCCcccHHHHHHHHH
Q 030405 33 PEALARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILDFEEFARALS 112 (178)
Q Consensus 33 ~~~~~~~~~~~~~~i~~l~~~F~~~d~~~~~~g~i~~~ef~~~l~~~~~~~~~~~~~lf~~~d~~~~g~i~~~ef~~~~~ 112 (178)
++.+...+.||++++..|++.|..+|.+..++|.|+..+|..++...+...++.++++|+.+|.+++|.|+|+||+.++.
T Consensus 2 ~~~l~~~t~Fs~~ei~~L~~~F~~~d~~~~~~G~i~~~ef~~~l~~~~~~~~~~~~~lf~~~d~~~dg~I~f~EFl~~l~ 81 (183)
T d2zfda1 2 PELLARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALS 81 (183)
T ss_dssp THHHHHHSSCCHHHHHHHHHHHHHHHTSSSCSSSBCHHHHHHHHHSCSSCCCHHHHHHHHHHCSSCSSSBCHHHHHHHHH
T ss_pred HHHHhhhCCCCHHHHHHHHHHHHHHCcCCCCCCcCcHHHHHHHHHhcCCCCCHHHHHHHHHHccCCCCcCcHHHHHHHHH
Confidence 45688899999999999999999998764468999999999998776666667789999999999999999999999998
Q ss_pred hhCCCCChhHHHHHHHHhhCCCCCCceeHHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHhhccC
Q 030405 113 IFHPNSPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLTESGMNLSDDVIESIIDKVLSLIQL 177 (178)
Q Consensus 113 ~~~~~~~~~e~~~~~F~~~D~d~~G~I~~~e~~~~l~~~~~~~~~~l~~~~~~~~~~~~~~~~D~ 177 (178)
.+......++.++.+|+.||.|++|.|+.+|+..++..++...+..+++.+++.+++.+|.++|.
T Consensus 82 ~~~~~~~~~~~~~~~F~~~D~d~~G~Is~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~if~~~D~ 146 (183)
T d2zfda1 82 VFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKTFEEADT 146 (183)
T ss_dssp HTSTTSCHHHHHHHHHHHHCTTSSSSEEHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHCS
T ss_pred hhhccCcHHHHHHHhhcccccCCCCCccHHHHHHHHHHHHhhhhcccchHHHHHHHHHHHHHhCC
Confidence 88765677889999999999999999999999999999888888889999999999999999884
|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eg3a1 a.39.1.7 (A:85-209) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|