Citrus Sinensis ID: 030406

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18

MVEPAVIGTKNVIVAAAEAKVRRVVFTSSIGAVYMDPNRSPDDVVDESCWSDLEFCKNTKNWYCYGKAVAEKAAWEEAVARGVDLVVVNPVLVLGPLLQSTVNASIIHILKYLNGSAKTYANSVQAYVHVRDVALAHILVYETPSASGRYLCAESVLHRGEVVEILAKFFPEYPIPTK

cccHHHHHHHHHHHHHHHccccEEEEcccccEEEccccccccccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccHHHHHHHHccccccccccccEEEEHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHccccccccc

MVEPAVIGTKNVIVAAAEAKVRRVVFTSSIGAVYMDPNRSPDDVVDESCWSDLEFCKNTKNWYCYGKAVAEKAAWEEAVARGVDLVVVNPVLVLGPLLQSTVNASIIHILKYLNGSAKTYANSVQAYVHVRDVALAHILVYETPSASGRYLCAESVLHRGEVVEILAKFFPEYPI***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVEPAVIGTKNVIVAAAEAKVRRVVFTSSIGAVYMDPNRSPDDVVDESCWSDLEFCKNTKNWYCYGKAVAEKAAWEEAVARGVDLVVVNPVLVLGPLLQSTVNASIIHILKYLNGSAKTYANSVQAYVHVRDVALAHILVYETPSASGRYLCAESVLHRGEVVEILAKFFPEYPIPTK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cinnamoyl-CoA reductase 1	Involved in the latter stages of lignin biosynthesis. Catalyzes one of the last steps of monolignol biosynthesis, the conversion of cinnamoyl-CoAs into their corresponding cinnamaldehydes.	probable	Q9S9N9

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RH8, chain A
Confidence level:very confident
Coverage over the Query: 2-176
View the alignment between query and template
View the model in PyMOL