Citrus Sinensis ID: 030438

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------

MLIGLIIIGGEAIMSYKGLNLRKEVKKVIHLVLHAIALILGIIGIYAAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWLYGFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTFLENSGLAKYGSEALLVNFTAVITILYGAFVIFSVASQGPAEDDYSYSAI

cEEEHHHHHHHHHHHEEEccccccHHHHHHHHHHHHHHHHHHHHHHEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc

MLIGLIIIGGEAIMSYKGLNLRKEVKKVIHLVLHAIALILGIIGIYAAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWLYGFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTFLENSGLAKYGSEALLVNFTAVITILYGAFVIFSVA**************

xxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLIGLIIIGGEAIMSYKGLNLRKEVKKVIHLVLHAIALILGIIGIYAAFKYHNESAIVNLYSLHSWLGIAVISLYGIQWLYGFVIFFYPGGSTGLRSESLPWHVLFGLFVYILAVANAAIGFLEKLTFLENSGLAKYGSEALLVNFTAVITILYGAFVIFSVASQGPAEDDYSYSAI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transmembrane ascorbate ferrireductase 1	Two-heme-containing cytochrome. Catalyzes ascorbate-dependent trans-membrane ferric-chelate reduction.	probable	Q8L856
Probable ascorbate-specific transmembrane electron transporter 1	Two-heme-containing cytochrome. Catalyzes ascorbate-dependent trans-membrane electron transfer by utilizing a concerted H(+)/e(-) transfer mechanism.	probable	A3A9H6
Probable ascorbate-specific transmembrane electron transporter 2	Two-heme-containing cytochrome. Catalyzes ascorbate-dependent trans-membrane electron transfer by utilizing a concerted H(+)/e(-) transfer mechanism.	probable	Q7XMK3

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KQF, chain C
Confidence level:probable
Coverage over the Query: 26-123
View the alignment between query and template
View the model in PyMOL