Citrus Sinensis ID: 030459


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MIDAFAESQGISMNTVHCKATFGQGFVGDAPVLLAKPQTYMNLSGESTGPLAAYYKLPLNRVLVFHDDMGLPCGVLRLRHNGGHGGHNGLKSVMNNFRGNREFARLRIGIGRPPGQMDPKAFLLQKFNAIARERIDTALQEGVEVLKLLLSKGLTESARHFNTIQKYKHIRLQNMPA
cHHHHHHHcccccccccccEEEEEEEEccEEEEEEccccccccccccHHHHHHHcccccccEEEEEcccccccccEEEEccccccccccHHHHHHHHcccccccEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccc
MIDAFAESQGISMNTVHCKATFGQGFVGDAPVLLAKPQTYMNLSGESTGPLAAYYKLPLNRVLVFHDDMGLPCGVLRLRHNGGHGGHNGLKSVMNNFRGNREFARLRIGIGRPPGQMDPKAFLLQKFNAIARERIDTALQEGVEVLKLLLSKGLTESARHFNTIQK***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIDAFAESQGISMNTVHCKATFGQGFVGDAPVLLAKPQTYMNLSGESTGPLAAYYKLPLNRVLVFHDDMGLPCGVLRLRHNGGHGGHNGLKSVMNNFRGNREFARLRIGIGRPPGQMDPKAFLLQKFNAIARERIDTALQEGVEVLKLLLSKGLTESARHFNTIQKYKHIRLQNMPA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-tRNA hydrolase, mitochondrial The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis. May also be required for the splicing of group IIB introns in mitochondrions.probableQ6NLS8
Peptidyl-tRNA hydrolase The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.probableQ63HI2
Peptidyl-tRNA hydrolase The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.probableQ2J5Z1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.1.-Carboxylic ester hydrolases.probable
3.1.1.29Aminoacyl-tRNA hydrolase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RYB, chain A
Confidence level:very confident
Coverage over the Query: 1-163
View the alignment between query and template
View the model in PyMOL