Citrus Sinensis ID: 030477

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MAQDSKRSRPNILVTGTPGTGKTTTSTALAESTQLRHINIGELVREKNLHDGWDDELECHVINEDLVCDELEDIMEQGGNIVDYHGCDFFPERWFDRVVVLQTENSVLYDRLTKRGYTGAKLTNNIECEIFQVLLEEAKESYPEDIVLALKSDTIEDITRNIAILTDWVRNWQPRS
cccccccccccEEEEccccccHHHHHHHHHHHHccEEEEHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccEEEEcccccccccccccEEEEEEcccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHccccc
***********ILVTGTPGTGKTTTSTALAESTQLRHINIGELVREKNLHDGWDDELECHVINEDLVCDELEDIMEQGGNIVDYHGCDFFPERWFDRVVVLQTENSVLYDRLTKRGYTGAKLTNNIECEIFQVLLEEAKESYPEDIVLALKSDTIEDITRNIAILTDWVRNWQ***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQDSKRSRPNILVTGTPGTGKTTTSTALAESTQLRHINIGELVREKNLHDGWDDELECHVINEDLVCDELEDIMEQGGNIVDYHGCDFFPERWFDRVVVLQTENSVLYDRLTKRGYTGAKLTNNIECEIFQVLLEEAKESYPEDIVLALKSDTIEDITRNIAILTDWVRNWQPRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable adenylate kinase isoenzyme 6 probableQ09527
Probable adenylate kinase isoenzyme 6 probableQ54Y03
Adenylate kinase isoenzyme 6 Broad activity as an NMP kinase. AMP and dAMP are the preferred substrates of all tested NMPs, but CMP and dCMP are also good substrates. IMP can be phosphorylated, but to a much lesser extent. Adenylate and cytidylate can serve as phosphate acceptors.probableA5PJA1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.4.-2,7,4'-trihydroxyisoflavanone 4'-O-methyltransferase.probable
2.7.4.3Adenylate kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IIJ, chain A
Confidence level:very confident
Coverage over the Query: 4-173
View the alignment between query and template
View the model in PyMOL