Citrus Sinensis ID: 030478

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MEKMNHAFEKMKMLVGMDVEDEESAVENDSNSFAFIDDFNRQCTLTTKQRLYGFAICFSVGIFCTLLSLLVFFNPIKFGITFTFGNLLSLGSTAFLIGPKRQVTMMLDPARIYATAIYIASMIIALFSALYVHNKLLTLLALILEFGALIWYSLSYIPFARSMVSKIMLACFDTEF
cHHHHHHHHHHHHHcccccccccHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccc
*********************************AFIDDFNRQCTLTTKQRLYGFAICFSVGIFCTLLSLLVFFNPIKFGITFTFGNLLSLGSTAFLIGPKRQVTMMLDPARIYATAIYIASMIIALFSALYVHNKLLTLLALILEFGALIWYSLSYIPFARSMVSKIMLACFDTEF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKMNHAFEKMKMLVGMDVEDEESAVENDSNSFAFIDDFNRQCTLTTKQRLYGFAICFSVGIFCTLLSLLVFFNPIKFGITFTFGNLLSLGSTAFLIGPKRQVTMMLDPARIYATAIYIASMIIALFSALYVHNKLLTLLALILEFGALIWYSLSYIPFARSMVSKIMLACFDTEF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vesicle transport protein SFT2B May be involved in fusion of retrograde transport vesicles derived from an endocytic compartment with the Golgi complex.probableO95562
Vesicle transport protein SFT2A May be involved in fusion of retrograde transport vesicles derived from an endocytic compartment with the Golgi complex.probableQ5U3Y5
Vesicle transport protein SFT2B May be involved in fusion of retrograde transport vesicles derived from an endocytic compartment with the Golgi complex.probableQ8VD57

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted