Citrus Sinensis ID: 030479


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MSRFRGLWQASLNATKRALTWNLEELMPPSERYIFNFNSKEELKKWHLYSDSEYGGLSSASLEITESGNGMNGIFSGNLSLDLSEGSKWNISRSGFCGMRSKKFDGFIDLDSYDTIAMKLKGDGRCYISTIYTENWVNSPGQQEDNSWQSFVFVPKDNWYIAKVSSFLLNLIFSET
cccHHHHHHHHHHHHHHHHHHcccccccccccEEEEcccHHccccCEEECccCCccEEEEEEEECccccccEEEEEEEEEccccccccccCCcccEEEEECcccccccccccccEEEEEEECcccEEEEEEEEccccccccccccccEEEEEEcccccEEEEEEccccEEEEEccc
**RFRGLWQASLNATKRALTWNLEELMPPSERYIFNFNSKEELKKWHLYSDSEYGGLSSASLEITESGNGMNGIFSGNLSLDLSEGSKWNISRSGFCGMRSKKFDGFIDLDSYDTIAMKLKGDGRCYISTIYTENWVNSPGQQEDNSWQSFVFVPKDNWYIAKVSSFLLNLIFS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRFRGLWQASLNATKRALTWNLEELMPPSERYIFNFNSKEELKKWHLYSDSEYGGLSSASLEITESGNGMNGIFSGNLSLDLSEGSKWNISRSGFCGMRSKKFDGFIDLDSYDTIAMKLKGDGRCYISTIYTENWVNSPGQQEDNSWQSFVFVPKDNWYIAKVSSFLLNLIFSET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable complex I intermediate-associated protein 30 Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I).probableQ9LQI7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V0A, chain A
Confidence level:confident
Coverage over the Query: 29-170
View the alignment between query and template
View the model in PyMOL