Citrus Sinensis ID: 030510


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MDETCWSDKEYCRTTNNWYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPLLQSNVNSSSLVLIKRLKGYESLENRLRMIVDVRDVAEALLLAYEKAEAEGRYICTAHLIRERDLFDKLKSLYPNYNYPKNFTEGREDVTMSSEKLQRLGWSFRPLEETLIDSIESYKKAGILD
ccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHccccccccccccEEEHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHccccccccccccccccccccHHHHHccccccccHHHHHHHHHHHHHHccccc
ccccccccHHHHHHcccEEEHHHHHHHHHHHHHHHHccccEEEEcccEEEcccccccccHHHHHHHHHHcccccHHHHHHHHccHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHcccccccccccccccccEEcHHHHHHcccEEccHHHHHHHHHHHHHHccccc
mdetcwsdkeycrttnnwyclSKTEAESEALEFAKRtgldvvtvcpnliwgpllqsnvnSSSLVLIKRLKGYESLENRLRMIVDVRDVAEALLLAYEKAEAEGRYICTAHLIRERDLFDKLkslypnynypknftegredvtmSSEKLQRLGWSFRPLEETLIDSIESYKKAGILD
mdetcwsdkeycrttnnwycLSKTEAESEALEFAKRTGLDVVTVCPNLIWgpllqsnvnssSLVLIKRLKGYESLENRLRMIVDVRDVAEALLLAYEKAEAEGRYICTAHLIRERDLFDKLKSLYPNynypknftegredvtMSSEKLQRLgwsfrpleetlidsiesykkagild
MDETCWSDKEYCRTTNNWYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPllqsnvnssslvlIKRLKGYESLENRLRMIVDVRDVaealllayekaeaeGRYICTAHLIRERDLFDKLKSLYPNYNYPKNFTEGREDVTMSSEKLQRLGWSFRPLEETLIDSIESYKKAGILD
****CWSDKEYCRTTNNWYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPLLQSNVNSSSLVLIKRLKGYESLENRLRMIVDVRDVAEALLLAYEKAEAEGRYICTAHLIRERDLFDKLKSLYPNYNYPKNFTE***********LQRLGWSFRPLEETLIDSI**********
MDETCWSDKEYCRTTNNWYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPLLQSNVNSSSLVLIKRLKGYESLENRLRMIVDVRDVAEALLLAYEKAEAEGRYICTAHLIRERDLFDKLKSLYPNYNYP************SSEKLQRLGWSFRPLEETLIDSIESYKKAGILD
MDETCWSDKEYCRTTNNWYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPLLQSNVNSSSLVLIKRLKGYESLENRLRMIVDVRDVAEALLLAYEKAEAEGRYICTAHLIRERDLFDKLKSLYPNYNYPKNFTEGREDVTMSSEKLQRLGWSFRPLEETLIDSIESYKKAGILD
***TCWSDKEYCRTTNNWYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPLLQSNVNSSSLVLIKRLKGYESLENRLRMIVDVRDVAEALLLAYEKAEAEGRYICTAHLIRERDLFDKLKSLYPNYNYPKNFTEGREDVTMSSEKLQRLGWSFRPLEETLIDSIESYKKA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDETCWSDKEYCRTTNNWYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPLLQSNVNSSSLVLIKRLKGYESLENRLRMxxxxxxxxxxxxxxxxxxxxxGRYICTAHLIRERDLFDKLKSLYPNYNYPKNFTEGREDVTMSSEKLQRLGWSFRPLEETLIDSIESYKKAGILD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query176 2.2.26 [Sep-21-2011]
Q9SAH9332 Cinnamoyl-CoA reductase 2 no no 0.994 0.527 0.355 9e-25
P51110337 Dihydroflavonol-4-reducta no no 0.988 0.516 0.349 3e-24
Q500U8326 Tetraketide alpha-pyrone no no 0.994 0.536 0.353 2e-23
Q9CA28321 Tetraketide alpha-pyrone no no 0.994 0.545 0.344 3e-23
Q9S9N9344 Cinnamoyl-CoA reductase 1 no no 0.994 0.508 0.35 4e-22
P51106354 Dihydroflavonol-4-reducta N/A no 0.988 0.491 0.316 1e-21
P51102382 Dihydroflavonol-4-reducta no no 0.988 0.455 0.338 1e-21
Q9XES5348 Bifunctional dihydroflavo N/A no 0.988 0.5 0.322 3e-21
Q84KP0347 Bifunctional dihydroflavo N/A no 0.988 0.501 0.316 9e-21
P51108357 Dihydroflavonol-4-reducta N/A no 0.988 0.487 0.320 4e-19
>sp|Q9SAH9|CCR2_ARATH Cinnamoyl-CoA reductase 2 OS=Arabidopsis thaliana GN=CCR2 PE=1 SV=1 Back     alignment and function desciption
 Score =  112 bits (281), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 64/180 (35%), Positives = 106/180 (58%), Gaps = 5/180 (2%)

Query: 1   MDETCWSDKEYCRTTNNWYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPLLQSNVNS 60
           +DE CWSD ++C+ T NWYC  K  AE  A E AK  G+D+V + P L+ GP LQS +N+
Sbjct: 138 VDENCWSDLDFCKNTKNWYCYGKMLAEQSAWETAKAKGVDLVVLNPVLVLGPPLQSAINA 197

Query: 61  SSLVLIKRLKG-YESLENRLRMIVDVRDVAEALLLAYEKAEAEGRYICTAHLIRERDLFD 119
           S + ++K L G  ++  N  ++ VDVRDVA   +L YE   A GRYI     +   ++ +
Sbjct: 198 SLVHILKYLTGSAKTYANLTQVYVDVRDVALGHVLVYEAPSASGRYILAETALHRGEVVE 257

Query: 120 KLKSLYPNYNYPKNFTEGR----EDVTMSSEKLQRLGWSFRPLEETLIDSIESYKKAGIL 175
            L   +P Y  P   ++ +    +    +++K++ LG  F+P++++L +S++S ++ G L
Sbjct: 258 ILAKFFPEYPLPTKCSDEKNPRAKPYKFTTQKIKDLGLEFKPIKQSLYESVKSLQEKGHL 317




Cinnamoyl-CoA reductase probably involved in the formation of phenolic compounds associated with the hypersensitive response. Seems not to be involved in lignin biosynthesis.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 4EC: 4
>sp|P51110|DFRA_VITVI Dihydroflavonol-4-reductase OS=Vitis vinifera GN=DFR PE=1 SV=1 Back     alignment and function description
>sp|Q500U8|TKPR1_ARATH Tetraketide alpha-pyrone reductase 1 OS=Arabidopsis thaliana GN=TKPR1 PE=2 SV=1 Back     alignment and function description
>sp|Q9CA28|TKPR2_ARATH Tetraketide alpha-pyrone reductase 2 OS=Arabidopsis thaliana GN=TKPR2 PE=2 SV=1 Back     alignment and function description
>sp|Q9S9N9|CCR1_ARATH Cinnamoyl-CoA reductase 1 OS=Arabidopsis thaliana GN=CCR1 PE=1 SV=1 Back     alignment and function description
>sp|P51106|DFRA_HORVU Dihydroflavonol-4-reductase OS=Hordeum vulgare GN=ANT18 PE=3 SV=1 Back     alignment and function description
>sp|P51102|DFRA_ARATH Dihydroflavonol-4-reductase OS=Arabidopsis thaliana GN=DFRA PE=3 SV=2 Back     alignment and function description
>sp|Q9XES5|DFRA_MALDO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Malus domestica GN=DFR PE=1 SV=1 Back     alignment and function description
>sp|Q84KP0|DFRA_PYRCO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Pyrus communis GN=DFR PE=1 SV=1 Back     alignment and function description
>sp|P51108|DFRA_MAIZE Dihydroflavonol-4-reductase OS=Zea mays GN=A1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
225457658 318 PREDICTED: bifunctional dihydroflavonol 1.0 0.553 0.762 7e-76
225457654 319 PREDICTED: bifunctional dihydroflavonol 0.994 0.548 0.767 2e-75
224061829 319 predicted protein [Populus trichocarpa] 1.0 0.551 0.768 6e-73
255539330 320 cinnamoyl-CoA reductase, putative [Ricin 0.994 0.546 0.745 2e-72
388516021 326 unknown [Medicago truncatula] 0.994 0.536 0.670 7e-66
357458847 326 Dihydroflavonol-4-reductase [Medicago tr 0.994 0.536 0.659 3e-64
328930000 321 cinnamoyl-CoA reductase [Salvia miltiorr 0.994 0.545 0.655 7e-64
255539332 319 cinnamoyl-CoA reductase, putative [Ricin 0.994 0.548 0.672 1e-63
449455647 319 PREDICTED: cinnamoyl-CoA reductase 2-lik 1.0 0.551 0.651 2e-63
297823153 321 predicted protein [Arabidopsis lyrata su 1.0 0.548 0.668 5e-62
>gi|225457658|ref|XP_002275562.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [Vitis vinifera] gi|297745607|emb|CBI40772.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  288 bits (736), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 157/177 (88%), Gaps = 1/177 (0%)

Query: 1   MDETCWSDKEYCRTTNNWYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPLLQSNVNS 60
           MDETCWSDKEYCR T NWYCLSKTEAES A E+AK +GLDVVTVCP L+ GP+LQS +N+
Sbjct: 142 MDETCWSDKEYCRATKNWYCLSKTEAESVAFEYAKTSGLDVVTVCPTLVLGPILQSTINA 201

Query: 61  SSLVLIKRLK-GYESLENRLRMIVDVRDVAEALLLAYEKAEAEGRYICTAHLIRERDLFD 119
           SSLVLIK LK GYE+LEN+ RMIVDVRDVA+ALL+ YEK EAEGRYICTAH+I+ RDL +
Sbjct: 202 SSLVLIKILKEGYETLENKFRMIVDVRDVADALLITYEKPEAEGRYICTAHMIKARDLVE 261

Query: 120 KLKSLYPNYNYPKNFTEGREDVTMSSEKLQRLGWSFRPLEETLIDSIESYKKAGILD 176
           KL+S+YPNYNYPKNFTE  E   +SSEKLQ+LGWS+RPLEE+L+DSI+SYK+AGILD
Sbjct: 262 KLRSIYPNYNYPKNFTEVEEVENLSSEKLQKLGWSYRPLEESLVDSIKSYKEAGILD 318




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225457654|ref|XP_002275693.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [Vitis vinifera] gi|297745605|emb|CBI40770.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224061829|ref|XP_002300619.1| predicted protein [Populus trichocarpa] gi|222842345|gb|EEE79892.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255539330|ref|XP_002510730.1| cinnamoyl-CoA reductase, putative [Ricinus communis] gi|223551431|gb|EEF52917.1| cinnamoyl-CoA reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388516021|gb|AFK46072.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357458847|ref|XP_003599704.1| Dihydroflavonol-4-reductase [Medicago truncatula] gi|357468097|ref|XP_003604333.1| Dihydroflavonol-4-reductase [Medicago truncatula] gi|355488752|gb|AES69955.1| Dihydroflavonol-4-reductase [Medicago truncatula] gi|355505388|gb|AES86530.1| Dihydroflavonol-4-reductase [Medicago truncatula] Back     alignment and taxonomy information
>gi|328930000|gb|AEB69789.1| cinnamoyl-CoA reductase [Salvia miltiorrhiza] Back     alignment and taxonomy information
>gi|255539332|ref|XP_002510731.1| cinnamoyl-CoA reductase, putative [Ricinus communis] gi|223551432|gb|EEF52918.1| cinnamoyl-CoA reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449455647|ref|XP_004145563.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Cucumis sativus] gi|449485070|ref|XP_004157062.1| PREDICTED: cinnamoyl-CoA reductase 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297823153|ref|XP_002879459.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297325298|gb|EFH55718.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
TAIR|locus:2051008321 CRL1 "CCR(Cinnamoyl coA:NADP o 1.0 0.548 0.516 7.4e-50
TAIR|locus:2051018321 CRL2 "CCR(Cinnamoyl coA:NADP o 1.0 0.548 0.539 2e-49
TAIR|locus:2011741325 AT1G76470 [Arabidopsis thalian 0.988 0.535 0.433 6.7e-33
TAIR|locus:2025832332 CCR2 "cinnamoyl coa reductase" 0.994 0.527 0.3 4.3e-22
TAIR|locus:2171258324 AT5G58490 [Arabidopsis thalian 0.988 0.537 0.342 1.5e-21
TAIR|locus:2012315322 AT1G09510 [Arabidopsis thalian 0.965 0.527 0.337 1.3e-20
TAIR|locus:2200427344 CCR1 "cinnamoyl coa reductase 0.988 0.505 0.309 2.7e-20
TAIR|locus:2122093326 DRL1 "dihydroflavonol 4-reduct 0.994 0.536 0.325 9.2e-20
TAIR|locus:2012250369 AT1G09480 [Arabidopsis thalian 0.994 0.474 0.325 1.8e-19
TAIR|locus:2033904325 AT1G51410 [Arabidopsis thalian 0.994 0.538 0.286 3.1e-19
TAIR|locus:2051008 CRL1 "CCR(Cinnamoyl coA:NADP oxidoreductase)-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 519 (187.8 bits), Expect = 7.4e-50, P = 7.4e-50
 Identities = 92/178 (51%), Positives = 125/178 (70%)

Query:     1 MDETCWSDKEYCRTTNNWYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPXXXXXXXX 60
             +DE CWSD+EYC+ T NWYCL+KT AESEA EFAKRTGL +V+VCP L+ GP        
Sbjct:   144 LDEACWSDQEYCKKTENWYCLAKTRAESEAFEFAKRTGLHLVSVCPTLVLGPILQQNTVN 203

Query:    61 XXXXXIKRL--KGYESLENRLRMIVDVRDVXXXXXXXXXXXXXXGRYICTAHLIRERDLF 118
                  + +L  +G+E+ +N+ R +VDVRDV              GRYICT+H ++E  + 
Sbjct:   204 ASSLVLLKLLKEGFETRDNQERHLVDVRDVAQALLLVYEKAEAEGRYICTSHTVKEEIVV 263

Query:   119 DKLKSLYPNYNYPKNFTEGREDVTMSSEKLQRLGWSFRPLEETLIDSIESYKKAGILD 176
             +KLKS YP+YNYPK + +  + V +SSEKLQ+LGW++RPLEETL+DS+ESY+KA ++D
Sbjct:   264 EKLKSFYPHYNYPKKYIDAEDRVKVSSEKLQKLGWTYRPLEETLVDSVESYRKAKLVD 321




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0009809 "lignin biosynthetic process" evidence=ISS
GO:0016621 "cinnamoyl-CoA reductase activity" evidence=ISS
GO:0050662 "coenzyme binding" evidence=IEA
GO:0009408 "response to heat" evidence=IEP
GO:0009414 "response to water deprivation" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0046686 "response to cadmium ion" evidence=IEP
TAIR|locus:2051018 CRL2 "CCR(Cinnamoyl coA:NADP oxidoreductase)-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011741 AT1G76470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025832 CCR2 "cinnamoyl coa reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171258 AT5G58490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012315 AT1G09510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200427 CCR1 "cinnamoyl coa reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122093 DRL1 "dihydroflavonol 4-reductase-like1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012250 AT1G09480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033904 AT1G51410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00002940001
SubName- Full=Chromosome chr18 scaffold_137, whole genome shotgun sequence; (220 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
cd08958293 cd08958, FR_SDR_e, flavonoid reductase (FR), exten 7e-66
PLN02662322 PLN02662, PLN02662, cinnamyl-alcohol dehydrogenase 1e-41
PLN02650351 PLN02650, PLN02650, dihydroflavonol-4-reductase 2e-32
PLN02986322 PLN02986, PLN02986, cinnamyl-alcohol dehydrogenase 3e-32
PLN02214342 PLN02214, PLN02214, cinnamoyl-CoA reductase 3e-31
PLN00198338 PLN00198, PLN00198, anthocyanidin reductase; Provi 2e-29
cd05193295 cd05193, AR_like_SDR_e, aldehyde reductase, flavon 3e-29
PLN02989325 PLN02989, PLN02989, cinnamyl-alcohol dehydrogenase 1e-24
cd05228318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 2e-24
cd05227301 cd05227, AR_SDR_e, aldehyde reductase, extended (e 1e-23
PLN02686367 PLN02686, PLN02686, cinnamoyl-CoA reductase 1e-21
PLN02896353 PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase 2e-19
PLN02583297 PLN02583, PLN02583, cinnamoyl-CoA reductase 3e-16
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 1e-14
TIGR03466328 TIGR03466, HpnA, hopanoid-associated sugar epimera 1e-12
cd08957307 cd08957, WbmH_like_SDR_e, Bordetella bronchiseptic 4e-05
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 5e-05
PLN02725306 PLN02725, PLN02725, GDP-4-keto-6-deoxymannose-3,5- 3e-04
cd05232303 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, 0.001
>gnl|CDD|187661 cd08958, FR_SDR_e, flavonoid reductase (FR), extended (e) SDRs Back     alignment and domain information
 Score =  202 bits (517), Expect = 7e-66
 Identities = 73/157 (46%), Positives = 102/157 (64%), Gaps = 4/157 (2%)

Query: 1   MDETCWSDKEYCRTTNNWYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPLLQSNVNS 60
           +DE+CWSD ++C+ T  WY LSKT AE  A EFA+  GLD+VTV P+L+ GP LQ ++NS
Sbjct: 137 VDESCWSDLDFCKKTKLWYALSKTLAEKAAWEFAEENGLDLVTVNPSLVVGPFLQPSLNS 196

Query: 61  SSLVLIKRLKG-YESLENRLRMIVDVRDVAEALLLAYEKAEAEGRYICTAHLIRERDLFD 119
           SS +++  LKG  E  +N    +V V DVA+A +L YEK  A GRYIC++H++   +L  
Sbjct: 197 SSQLILSLLKGNAEMYQNGSLALVHVDDVADAHILLYEKPSASGRYICSSHVVTRPELAA 256

Query: 120 KLKSLYPNYNYPKNFTEGRED---VTMSSEKLQRLGW 153
            L   YP YN P  F + +     V +SS+KL+ LG+
Sbjct: 257 LLAKKYPQYNIPTKFEDDQPGVARVKLSSKKLKDLGF 293


This subgroup contains FRs of the extended SDR-type and related proteins. These FRs act in the NADP-dependent reduction of flavonoids, ketone-containing plant secondary metabolites; they have the characteristic active site triad of the SDRs (though not the upstream active site Asn) and a NADP-binding motif that is very similar to the typical extended SDR motif. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 293

>gnl|CDD|178268 PLN02662, PLN02662, cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|178256 PLN02650, PLN02650, dihydroflavonol-4-reductase Back     alignment and domain information
>gnl|CDD|178567 PLN02986, PLN02986, cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|177862 PLN02214, PLN02214, cinnamoyl-CoA reductase Back     alignment and domain information
>gnl|CDD|215100 PLN00198, PLN00198, anthocyanidin reductase; Provisional Back     alignment and domain information
>gnl|CDD|187536 cd05193, AR_like_SDR_e, aldehyde reductase, flavonoid reductase, and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|178569 PLN02989, PLN02989, cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187538 cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|215370 PLN02686, PLN02686, cinnamoyl-CoA reductase Back     alignment and domain information
>gnl|CDD|178484 PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|178195 PLN02583, PLN02583, cinnamoyl-CoA reductase Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase Back     alignment and domain information
>gnl|CDD|187660 cd08957, WbmH_like_SDR_e, Bordetella bronchiseptica enzymes WbmH and WbmG-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|178326 PLN02725, PLN02725, GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>gnl|CDD|187543 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, subgroup 4, extended (e) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 176
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 100.0
PLN02214342 cinnamoyl-CoA reductase 100.0
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.97
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.97
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.97
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 99.96
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.96
PLN00198338 anthocyanidin reductase; Provisional 99.96
PLN02650351 dihydroflavonol-4-reductase 99.95
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 99.95
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.94
PLN02896353 cinnamyl-alcohol dehydrogenase 99.94
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.93
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.93
PLN02166436 dTDP-glucose 4,6-dehydratase 99.93
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.92
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.92
PLN02260 668 probable rhamnose biosynthetic enzyme 99.92
PLN02206442 UDP-glucuronate decarboxylase 99.92
PLN02572442 UDP-sulfoquinovose synthase 99.92
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.92
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.91
PLN02427386 UDP-apiose/xylose synthase 99.91
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.91
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.91
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.91
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.91
PLN02583297 cinnamoyl-CoA reductase 99.91
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.9
PLN02653340 GDP-mannose 4,6-dehydratase 99.9
PLN02686367 cinnamoyl-CoA reductase 99.9
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 99.9
PLN02240352 UDP-glucose 4-epimerase 99.89
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.88
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.88
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.88
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.87
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.85
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 99.84
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.84
PLN00016378 RNA-binding protein; Provisional 99.84
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.8
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.79
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.75
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 99.75
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 99.7
PRK05865 854 hypothetical protein; Provisional 99.7
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.68
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.67
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 99.65
PLN02996491 fatty acyl-CoA reductase 99.63
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.62
PRK07201 657 short chain dehydrogenase; Provisional 99.56
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.54
PLN02778298 3,5-epimerase/4-reductase 99.53
KOG3019315 consensus Predicted nucleoside-diphosphate sugar e 99.46
CHL00194317 ycf39 Ycf39; Provisional 99.45
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.4
PLN02260668 probable rhamnose biosynthetic enzyme 99.29
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 99.2
KOG2774366 consensus NAD dependent epimerase [General functio 99.2
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.16
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.11
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 99.1
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.1
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.07
PLN02503605 fatty acyl-CoA reductase 2 99.06
PRK12320 699 hypothetical protein; Provisional 98.99
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 98.98
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 98.98
KOG1221467 consensus Acyl-CoA reductase [Lipid transport and 98.62
PRK06482276 short chain dehydrogenase; Provisional 98.57
PRK09135249 pteridine reductase; Provisional 98.53
COG3320382 Putative dehydrogenase domain of multifunctional n 98.37
PRK07074257 short chain dehydrogenase; Provisional 98.31
PRK07775274 short chain dehydrogenase; Provisional 98.29
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 98.1
PF1395062 Epimerase_Csub: UDP-glucose 4-epimerase C-term sub 98.1
PRK08263275 short chain dehydrogenase; Provisional 98.09
PRK06914280 short chain dehydrogenase; Provisional 98.09
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 98.07
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 98.06
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.0
PRK05875276 short chain dehydrogenase; Provisional 97.99
PRK07806248 short chain dehydrogenase; Provisional 97.99
PRK06180277 short chain dehydrogenase; Provisional 97.98
KOG4288283 consensus Predicted oxidoreductase [General functi 97.92
PRK12935247 acetoacetyl-CoA reductase; Provisional 97.9
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.89
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 97.79
PRK05876275 short chain dehydrogenase; Provisional 97.77
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.77
PRK12829264 short chain dehydrogenase; Provisional 97.77
PRK06123248 short chain dehydrogenase; Provisional 97.73
PRK07774250 short chain dehydrogenase; Provisional 97.73
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.72
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 97.71
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.69
PRK07060245 short chain dehydrogenase; Provisional 97.68
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 97.66
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.66
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 97.64
PRK07067257 sorbitol dehydrogenase; Provisional 97.62
PRK12746254 short chain dehydrogenase; Provisional 97.56
PRK09134258 short chain dehydrogenase; Provisional 97.55
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 97.5
PRK08324681 short chain dehydrogenase; Validated 97.49
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.47
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 97.46
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 97.38
PRK12828239 short chain dehydrogenase; Provisional 97.38
PRK06138252 short chain dehydrogenase; Provisional 97.31
PRK08628258 short chain dehydrogenase; Provisional 97.3
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 97.3
PRK08017256 oxidoreductase; Provisional 97.24
PRK08219227 short chain dehydrogenase; Provisional 97.23
PRK12827249 short chain dehydrogenase; Provisional 97.14
PRK07890258 short chain dehydrogenase; Provisional 97.13
PRK06182273 short chain dehydrogenase; Validated 97.11
PRK06500249 short chain dehydrogenase; Provisional 97.1
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 97.01
PRK09186256 flagellin modification protein A; Provisional 97.0
PRK07523255 gluconate 5-dehydrogenase; Provisional 96.99
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.93
PRK05650270 short chain dehydrogenase; Provisional 96.9
PRK06181263 short chain dehydrogenase; Provisional 96.89
PRK06179270 short chain dehydrogenase; Provisional 96.87
PRK12744257 short chain dehydrogenase; Provisional 96.86
PRK12939250 short chain dehydrogenase; Provisional 96.83
PRK07453322 protochlorophyllide oxidoreductase; Validated 96.73
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.73
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.68
PRK06128300 oxidoreductase; Provisional 96.68
PRK06101240 short chain dehydrogenase; Provisional 96.65
PRK08264238 short chain dehydrogenase; Validated 96.62
PRK07041230 short chain dehydrogenase; Provisional 96.6
PRK06701290 short chain dehydrogenase; Provisional 96.52
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 96.51
PRK07577234 short chain dehydrogenase; Provisional 96.5
PRK05993277 short chain dehydrogenase; Provisional 96.47
PLN02253280 xanthoxin dehydrogenase 96.46
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 96.42
PRK07024257 short chain dehydrogenase; Provisional 96.4
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.35
PRK12937245 short chain dehydrogenase; Provisional 96.33
PRK06057255 short chain dehydrogenase; Provisional 96.3
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 96.3
PRK10538248 malonic semialdehyde reductase; Provisional 96.3
PRK12743256 oxidoreductase; Provisional 96.21
PRK05693274 short chain dehydrogenase; Provisional 96.18
PRK12747252 short chain dehydrogenase; Provisional 96.18
PRK07825273 short chain dehydrogenase; Provisional 96.14
PRK07454241 short chain dehydrogenase; Provisional 96.13
PRK06194287 hypothetical protein; Provisional 96.06
PRK09291257 short chain dehydrogenase; Provisional 96.04
PRK12742237 oxidoreductase; Provisional 96.0
PRK08251248 short chain dehydrogenase; Provisional 95.91
PRK06124256 gluconate 5-dehydrogenase; Provisional 95.86
PRK06947248 glucose-1-dehydrogenase; Provisional 95.8
PRK06924251 short chain dehydrogenase; Provisional 95.79
PRK05717255 oxidoreductase; Validated 95.72
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 95.65
PRK12824245 acetoacetyl-CoA reductase; Provisional 95.65
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.64
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.64
PRK07831262 short chain dehydrogenase; Provisional 95.57
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 95.5
PRK06198260 short chain dehydrogenase; Provisional 95.49
PRK06949258 short chain dehydrogenase; Provisional 95.46
PRK08085254 gluconate 5-dehydrogenase; Provisional 95.45
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.42
PRK07904253 short chain dehydrogenase; Provisional 95.41
PRK06841255 short chain dehydrogenase; Provisional 95.4
PRK08703239 short chain dehydrogenase; Provisional 95.34
PRK07109334 short chain dehydrogenase; Provisional 95.31
PRK08589272 short chain dehydrogenase; Validated 95.28
PRK07326237 short chain dehydrogenase; Provisional 95.25
PRK08213259 gluconate 5-dehydrogenase; Provisional 95.17
PRK07578199 short chain dehydrogenase; Provisional 95.12
PRK07832272 short chain dehydrogenase; Provisional 95.11
PRK07102243 short chain dehydrogenase; Provisional 95.1
PLN03209 576 translocon at the inner envelope of chloroplast su 95.0
PRK06196315 oxidoreductase; Provisional 94.99
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 94.88
PRK07576264 short chain dehydrogenase; Provisional 94.86
PRK07677252 short chain dehydrogenase; Provisional 94.82
PRK07035252 short chain dehydrogenase; Provisional 94.81
PRK12938246 acetyacetyl-CoA reductase; Provisional 94.8
PRK08277278 D-mannonate oxidoreductase; Provisional 94.77
TIGR02415254 23BDH acetoin reductases. One member of this famil 94.73
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 94.67
PRK06114254 short chain dehydrogenase; Provisional 94.62
PRK05867253 short chain dehydrogenase; Provisional 94.54
PRK06139330 short chain dehydrogenase; Provisional 94.54
PRK07069251 short chain dehydrogenase; Validated 94.53
PRK06484520 short chain dehydrogenase; Validated 94.52
PRK06523260 short chain dehydrogenase; Provisional 94.46
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.37
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 94.35
PRK07985294 oxidoreductase; Provisional 94.26
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 94.24
PRK09242257 tropinone reductase; Provisional 94.1
PRK06483236 dihydromonapterin reductase; Provisional 94.06
PRK06172253 short chain dehydrogenase; Provisional 93.93
PRK08936261 glucose-1-dehydrogenase; Provisional 93.87
PRK07478254 short chain dehydrogenase; Provisional 93.78
PRK05866293 short chain dehydrogenase; Provisional 93.69
PRK05872296 short chain dehydrogenase; Provisional 93.49
PRK07856252 short chain dehydrogenase; Provisional 93.48
PRK08265261 short chain dehydrogenase; Provisional 93.4
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 93.3
PRK07814263 short chain dehydrogenase; Provisional 93.22
PRK08267260 short chain dehydrogenase; Provisional 92.79
PRK06953222 short chain dehydrogenase; Provisional 92.75
PRK08643256 acetoin reductase; Validated 92.55
PRK06940275 short chain dehydrogenase; Provisional 92.47
PRK05599246 hypothetical protein; Provisional 92.16
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 92.1
PRK08226263 short chain dehydrogenase; Provisional 91.99
PRK09009235 C factor cell-cell signaling protein; Provisional 91.95
PRK07097265 gluconate 5-dehydrogenase; Provisional 91.77
PRK07023243 short chain dehydrogenase; Provisional 91.72
PRK08278273 short chain dehydrogenase; Provisional 91.66
PRK09072263 short chain dehydrogenase; Provisional 91.59
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.54
PRK07201657 short chain dehydrogenase; Provisional 91.17
PRK08177225 short chain dehydrogenase; Provisional 90.57
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 90.55
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 90.15
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 89.83
PRK07063260 short chain dehydrogenase; Provisional 89.53
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 89.51
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 89.25
PRK06398258 aldose dehydrogenase; Validated 89.22
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 88.99
PLN02780320 ketoreductase/ oxidoreductase 88.62
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 88.58
COG2910211 Putative NADH-flavin reductase [General function p 88.45
PLN00015308 protochlorophyllide reductase 87.93
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 87.61
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 87.43
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 87.0
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 86.34
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 86.32
PRK05884223 short chain dehydrogenase; Provisional 86.2
PRK07791286 short chain dehydrogenase; Provisional 86.05
PRK05855582 short chain dehydrogenase; Validated 86.0
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 85.98
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 85.82
PRK05854313 short chain dehydrogenase; Provisional 85.36
PRK06197306 short chain dehydrogenase; Provisional 85.22
COG0300265 DltE Short-chain dehydrogenases of various substra 84.14
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 83.37
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 83.31
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 83.09
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 82.65
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 82.57
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 82.39
PRK08340259 glucose-1-dehydrogenase; Provisional 81.78
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 81.65
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 81.51
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 80.23
PRK12367245 short chain dehydrogenase; Provisional 80.17
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
Probab=100.00  E-value=3.1e-32  Score=196.52  Aligned_cols=165  Identities=16%  Similarity=0.225  Sum_probs=146.0

Q ss_pred             CchhhhccCCchhhhhHHHHHHHHHHHHHhcCccEEEEcCCCeeCCCCCCCCCchHHHHHHHHcC--Ccccccc--ccce
Q 030510            7 SDKEYCRTTNNWYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPLLQSNVNSSSLVLIKRLKG--YESLENR--LRMI   82 (176)
Q Consensus         7 ~~~~~~~~~~~~Y~~sK~~~E~~~~~~~~~~~~~~~i~Rp~~v~G~~~~~~~~~~~~~~~~~~~g--~~~~~~~--~~~~   82 (176)
                      -+|..+.+|+|+|++||++++.++++|.+.+|++++|.||++.|||.+++. ..++.++.+.+.|  .+.+++|  .|||
T Consensus       140 FtE~tp~~PsSPYSASKAasD~lVray~~TYglp~~ItrcSNNYGPyqfpE-KlIP~~I~nal~g~~lpvYGdG~~iRDW  218 (340)
T COG1088         140 FTETTPYNPSSPYSASKAASDLLVRAYVRTYGLPATITRCSNNYGPYQFPE-KLIPLMIINALLGKPLPVYGDGLQIRDW  218 (340)
T ss_pred             cccCCCCCCCCCcchhhhhHHHHHHHHHHHcCCceEEecCCCCcCCCcCch-hhhHHHHHHHHcCCCCceecCCcceeee
Confidence            457778999999999999999999999999999999999999999999875 3788899999999  6666665  7999


Q ss_pred             eeHHHHHHHHHHHhccccCCcceEEe-ccccCHHHHHHHHHHhCCC--------CCCCCCCCCCCCcccCChHHH-HHhC
Q 030510           83 VDVRDVAEALLLAYEKAEAEGRYICT-AHLIRERDLFDKLKSLYPN--------YNYPKNFTEGREDVTMSSEKL-QRLG  152 (176)
Q Consensus        83 i~v~D~a~a~~~~~~~~~~~~~~~~~-~~~~s~~e~~~~i~~~~~~--------~~v~~~~~~~~~~~~~d~~k~-~~lG  152 (176)
                      +||+|-++|+..+++++..|+.||++ +...+..|+++.|.+.+++        +......++.+.++.+|.+|+ ++||
T Consensus       219 l~VeDh~~ai~~Vl~kg~~GE~YNIgg~~E~~Nlevv~~i~~~l~~~~~~~~~li~~V~DRpGHD~RYaid~~Ki~~eLg  298 (340)
T COG1088         219 LYVEDHCRAIDLVLTKGKIGETYNIGGGNERTNLEVVKTICELLGKDKPDYRDLITFVEDRPGHDRRYAIDASKIKRELG  298 (340)
T ss_pred             EEeHhHHHHHHHHHhcCcCCceEEeCCCccchHHHHHHHHHHHhCccccchhhheEeccCCCCCccceeechHHHhhhcC
Confidence            99999999999999999997788888 5678999999999999975        234455666777899999998 5999


Q ss_pred             Cccc-cHHHHHHHHHHHHHHc
Q 030510          153 WSFR-PLEETLIDSIESYKKA  172 (176)
Q Consensus       153 ~~p~-~~~~~l~~~~~~~~~~  172 (176)
                      |.|+ +|+++|+++++||.++
T Consensus       299 W~P~~~fe~GlrkTv~WY~~N  319 (340)
T COG1088         299 WRPQETFETGLRKTVDWYLDN  319 (340)
T ss_pred             CCcCCCHHHHHHHHHHHHHhc
Confidence            9999 9999999999999875



>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PF13950 Epimerase_Csub: UDP-glucose 4-epimerase C-term subunit; PDB: 1EK5_A 1I3K_B 1I3M_B 1HZJ_A 1EK6_A 1I3N_A 1I3L_A 2CNB_B 1GY8_D 1NAI_A Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
2c29_D337 Structure Of Dihydroflavonol Reductase From Vitis V 3e-19
2rh8_A338 Structure Of Apo Anthocyanidin Reductase From Vitis 1e-14
2p4h_X322 Crystal Structure Of Vestitone Reductase From Alfal 7e-08
>pdb|2C29|D Chain D, Structure Of Dihydroflavonol Reductase From Vitis Vinifera At 1.8 A. Length = 337 Back     alignment and structure

Iteration: 1

Score = 90.9 bits (224), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 58/183 (31%), Positives = 88/183 (48%), Gaps = 9/183 (4%) Query: 2 DETCWSDKEYCRT---TNNWYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPXXXXXX 58 DE+CWSD E+CR T Y +SKT AE A ++AK +D +T+ P L+ GP Sbjct: 143 DESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSM 202 Query: 59 XXXXXXXIKRLKGYESLENRLR--MIVDVRDVXXXXXXXXXXXXXXGRYICTAHLIRERD 116 + + G E+ + +R V + D+ GRYIC++H D Sbjct: 203 PPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILD 262 Query: 117 LFDKLKSLYPNYNYPKNFT---EGREDVTMSSEKLQRLGWSFR-PLEETLIDSIESYKKA 172 L L+ YP YN P F E + V SS+KL LG+ F+ LE+ ++++ + Sbjct: 263 LAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLEDMFTGAVDTCRAK 322 Query: 173 GIL 175 G+L Sbjct: 323 GLL 325
>pdb|2RH8|A Chain A, Structure Of Apo Anthocyanidin Reductase From Vitis Vinifera Length = 338 Back     alignment and structure
>pdb|2P4H|X Chain X, Crystal Structure Of Vestitone Reductase From Alfalfa (Medicago Sativa L.) Length = 322 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 1e-76
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 6e-76
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 2e-75
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 8e-55
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 1e-35
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 1e-23
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 1e-05
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 5e-05
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 4e-04
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 4e-04
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Length = 338 Back     alignment and structure
 Score =  231 bits (591), Expect = 1e-76
 Identities = 65/191 (34%), Positives = 95/191 (49%), Gaps = 15/191 (7%)

Query: 1   MDETCWSDKEYCRTTNN---WYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPLLQSN 57
           +DE  W+D E+  +       Y  SKT AE  A +FA+   +D++TV P L+ G  L S+
Sbjct: 147 VDEKNWTDIEFLTSAKPPTWGYPASKTLAEKAAWKFAEENNIDLITVIPTLMAGSSLTSD 206

Query: 58  VNSSSLVLIKRLKGYESLENRLRM---------IVDVRDVAEALLLAYEKAEAEGRYICT 108
           V SS  + +  + G E L N ++          I  V DV  A +   EK  A GRYIC 
Sbjct: 207 VPSSIGLAMSLITGNEFLINGMKGMQMLSGSVSIAHVEDVCRAHIFVAEKESASGRYICC 266

Query: 109 AHLIRERDLFDKLKSLYPNYNYPKNFTEGRED--VTMSSEKLQRLGWSFR-PLEETLIDS 165
           A      +L   L   YP Y  P +F +      + +SSEKL + G+SF+  +EE   +S
Sbjct: 267 AANTSVPELAKFLSKRYPQYKVPTDFGDFPPKSKLIISSEKLVKEGFSFKYGIEEIYDES 326

Query: 166 IESYKKAGILD 176
           +E +K  G+L 
Sbjct: 327 VEYFKAKGLLQ 337


>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Length = 322 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Length = 337 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Length = 342 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} Length = 313 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Length = 221 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Length = 311 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.94
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.94
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.94
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.94
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.94
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.94
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.94
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.93
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.93
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.93
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.92
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.92
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.92
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.92
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.92
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.92
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.92
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.92
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.92
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.91
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.91
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.91
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.91
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.91
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.91
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.91
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.91
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.91
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.91
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.91
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.91
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.91
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.91
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.91
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.9
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.9
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.9
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.9
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.9
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.89
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.89
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.89
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.89
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.89
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.89
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.88
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.88
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.88
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.88
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.87
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.87
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.87
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.86
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.86
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.86
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.85
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.85
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.76
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.72
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.69
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.69
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.65
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.63
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.6
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.59
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.57
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.57
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.5
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.46
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.42
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.35
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.29
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.29
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.27
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.24
1xq6_A253 Unknown protein; structural genomics, protein stru 99.19
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.16
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.1
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.09
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.06
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 98.88
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 98.86
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 98.84
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 98.82
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 98.82
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 98.81
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 98.8
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 98.76
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 98.73
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 98.53
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 98.5
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 98.49
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 98.41
1spx_A278 Short-chain reductase family member (5L265); paral 98.4
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 98.37
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 98.36
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 98.31
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 98.26
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 98.23
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 98.23
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 98.15
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 98.07
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 98.06
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 98.05
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 98.04
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 98.0
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 97.97
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 97.91
1xq1_A266 Putative tropinone reducatse; structural genomics, 97.88
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 97.87
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 97.86
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 97.85
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 97.85
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.84
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 97.83
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 97.81
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 97.81
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 97.79
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 97.78
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 97.78
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 97.78
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 97.76
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 97.75
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 97.75
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 97.74
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.72
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 97.72
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 97.71
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 97.7
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 97.7
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.69
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 97.68
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 97.68
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 97.68
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 97.65
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 97.63
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.62
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 97.62
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 97.6
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 97.58
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 97.56
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 97.55
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 97.54
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 97.52
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 97.52
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 97.52
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 97.51
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 97.51
1nff_A260 Putative oxidoreductase RV2002; directed evolution 97.49
3imf_A257 Short chain dehydrogenase; structural genomics, in 97.47
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 97.46
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 97.45
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 97.45
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 97.44
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 97.43
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 97.43
3tox_A280 Short chain dehydrogenase; structural genomics, PS 97.42
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.42
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.41
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 97.39
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 97.38
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 97.38
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 97.38
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 97.38
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 97.37
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 97.37
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 97.37
1xhl_A297 Short-chain dehydrogenase/reductase family member 97.36
3tjr_A301 Short chain dehydrogenase; structural genomics, se 97.34
3gem_A260 Short chain dehydrogenase; structural genomics, AP 97.34
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 97.33
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 97.33
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 97.31
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 97.3
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 97.29
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 97.29
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 97.27
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 97.27
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 97.26
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 97.26
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.25
4e4y_A244 Short chain dehydrogenase family protein; structur 97.25
3rih_A293 Short chain dehydrogenase or reductase; structural 97.25
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 97.23
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 97.23
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 97.22
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 97.22
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 97.22
1xkq_A280 Short-chain reductase family member (5D234); parra 97.2
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 97.2
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 97.2
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 97.19
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 97.19
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 97.19
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 97.18
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 97.17
4eso_A255 Putative oxidoreductase; NADP, structural genomics 97.16
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 97.16
3qlj_A322 Short chain dehydrogenase; structural genomics, se 97.14
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 97.14
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 97.13
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 97.1
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 97.09
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 97.09
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 97.08
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 97.08
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 97.07
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 97.06
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 97.06
3edm_A259 Short chain dehydrogenase; structural genomics, ox 97.05
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 97.05
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 97.04
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 97.04
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 97.03
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 97.03
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 97.03
3cxt_A291 Dehydrogenase with different specificities; rossma 97.01
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 97.01
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 97.0
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 96.99
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 96.99
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 96.99
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 96.99
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 96.99
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 96.93
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.93
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 96.91
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 96.91
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 96.9
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 96.88
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 96.88
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 96.88
4dqx_A277 Probable oxidoreductase protein; structural genomi 96.87
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 96.87
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 96.86
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 96.85
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 96.82
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 96.82
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.81
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 96.8
3tsc_A277 Putative oxidoreductase; structural genomics, seat 96.8
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 96.77
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 96.77
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.76
1ooe_A236 Dihydropteridine reductase; structural genomics, P 96.74
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 96.72
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 96.71
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 96.7
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 96.7
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 96.68
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 96.68
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 96.67
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 96.64
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 96.64
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 96.64
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 96.63
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 96.61
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 96.55
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 96.55
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 96.53
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 96.52
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 96.48
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 96.42
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 96.4
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 96.34
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 96.06
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 96.01
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 95.83
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 95.7
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 95.66
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 95.49
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 95.37
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 95.08
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 95.03
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 94.87
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 94.86
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 94.61
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 94.48
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 94.4
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 94.29
3e03_A274 Short chain dehydrogenase; structural genomics, PS 93.79
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 93.53
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 93.41
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 93.25
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 93.2
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 92.85
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 92.78
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 92.52
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 92.44
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 92.13
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 91.89
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 91.48
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 91.26
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 90.04
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 90.01
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 89.57
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 89.33
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 89.28
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 82.58
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
Probab=99.94  E-value=2.5e-26  Score=172.24  Aligned_cols=165  Identities=15%  Similarity=0.161  Sum_probs=129.3

Q ss_pred             CCchhhhccCCchhhhhHHHHHHHHHHHHHhcCccEEEEcCCCeeCCCCCCCCCchHHHHHHHHcC-Cc--ccc--cccc
Q 030510            6 WSDKEYCRTTNNWYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPLLQSNVNSSSLVLIKRLKG-YE--SLE--NRLR   80 (176)
Q Consensus         6 ~~~~~~~~~~~~~Y~~sK~~~E~~~~~~~~~~~~~~~i~Rp~~v~G~~~~~~~~~~~~~~~~~~~g-~~--~~~--~~~~   80 (176)
                      +.+|+.+..|.+.|+.||.++|.+++.++++.+++++++||+.||||+...  +.+..++..+..+ ..  ...  +..+
T Consensus       125 ~~~E~~~~~~~~~Y~~sK~~~e~~~~~~~~~~g~~~~ilRp~~v~G~~~~~--~~~~~~~~~~~~~~~~~~~~~~g~~~~  202 (313)
T 3ehe_A          125 PTPEDYPTHPISLYGASKLACEALIESYCHTFDMQAWIYRFANVIGRRSTH--GVIYDFIMKLKRNPEELEILGNGEQNK  202 (313)
T ss_dssp             SBCTTSCCCCCSHHHHHHHHHHHHHHHHHHHTTCEEEEEECSCEESTTCCC--SHHHHHHHHHHHCTTEEEESTTSCCEE
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHhcCCCEEEEeeccccCcCCCc--ChHHHHHHHHHcCCCceEEeCCCCeEE
Confidence            455666777889999999999999999999999999999999999998753  3566677777766 22  233  3478


Q ss_pred             ceeeHHHHHHHHHHHhccccCCcceEEe-ccccCHHHHHHHHHHhCCCC---CCCCC---CCCCCCcccCChHHHHHhCC
Q 030510           81 MIVDVRDVAEALLLAYEKAEAEGRYICT-AHLIRERDLFDKLKSLYPNY---NYPKN---FTEGREDVTMSSEKLQRLGW  153 (176)
Q Consensus        81 ~~i~v~D~a~a~~~~~~~~~~~~~~~~~-~~~~s~~e~~~~i~~~~~~~---~v~~~---~~~~~~~~~~d~~k~~~lG~  153 (176)
                      +|||++|+|++++.+++....++.||++ ++++|+.|+++.+.+.++..   ..+..   .........+|++|+++|||
T Consensus       203 ~~i~v~Dva~a~~~~~~~~~~~~~~ni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~d~~k~~~lG~  282 (313)
T 3ehe_A          203 SYIYISDCVDAMLFGLRGDERVNIFNIGSEDQIKVKRIAEIVCEELGLSPRFRFTGGDRGWKGDVPVMLLSIEKLKRLGW  282 (313)
T ss_dssp             CCEEHHHHHHHHHHHTTCCSSEEEEECCCSCCEEHHHHHHHHHHHTTCCCEEEEC------------CCBCCHHHHHHTC
T ss_pred             eEEEHHHHHHHHHHHhccCCCCceEEECCCCCeeHHHHHHHHHHHhCCCCceEECCCccCCccccceeccCHHHHHHcCC
Confidence            9999999999999999955445578877 67899999999999998642   11111   12222347899999998999


Q ss_pred             ccc-cHHHHHHHHHHHHHHc
Q 030510          154 SFR-PLEETLIDSIESYKKA  172 (176)
Q Consensus       154 ~p~-~~~~~l~~~~~~~~~~  172 (176)
                      +|+ +++++|+++++|++++
T Consensus       283 ~p~~~~~e~l~~~~~~~~~~  302 (313)
T 3ehe_A          283 KPRYNSEEAVRMAVRDLVED  302 (313)
T ss_dssp             CCSCCHHHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHhC
Confidence            999 9999999999999864



>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 176
d1y1pa1342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 4e-18
d1r6da_322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 5e-13
d2b69a1312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 2e-12
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 2e-09
d2c5aa1363 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T 3e-08
d1oc2a_346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 2e-06
d1rpna_321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 3e-06
d1e6ua_315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 1e-05
d2bkaa1232 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {H 0.002
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 0.002
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Aldehyde reductase II
species: Sporobolomyces salmonicolor [TaxId: 5005]
 Score = 77.9 bits (190), Expect = 4e-18
 Identities = 39/170 (22%), Positives = 61/170 (35%), Gaps = 14/170 (8%)

Query: 15  TNNWYCLSKTEAESEALEF--AKRTGLDVVTVCPNLIWGPLLQSNVNSSS-----LVLIK 67
           +   Y  SKTEAE  A +F    +    +  V PN   G +      S S     + L  
Sbjct: 172 SLWVYAASKTEAELAAWKFMDENKPHFTLNAVLPNYTIGTIFDPETQSGSTSGWMMSLFN 231

Query: 68  RLKGYESLENRLRMIVDVRDVAEALLLAYEKAEAEGRY-ICTAHLIRERDLFDKLKSLYP 126
                       +  V   D+    L      + E R    TA       +    + LYP
Sbjct: 232 GEVSPALALMPPQYYVSAVDIGLLHLGCLVLPQIERRRVYGTAGTFDWNTVLATFRKLYP 291

Query: 127 NYNYPKNFTEGRE-----DVTMSSEKLQRLGWS-FRPLEETLIDSIESYK 170
           +  +P +F +  +     D   S E L+ LG   +R +EE++ D + S  
Sbjct: 292 SKTFPADFPDQGQDLSKFDTAPSLEILKSLGRPGWRSIEESIKDLVGSET 341


>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.97
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.95
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.95
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.95
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.94
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.94
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.94
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.93
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.93
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.92
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.91
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.91
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.91
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.91
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.9
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.88
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.88
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.87
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.87
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.86
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.85
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.79
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 99.6
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.11
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.05
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.05
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.02
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 98.94
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 98.52
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.19
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 95.57
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 95.18
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 95.05
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 94.95
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 94.85
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 94.74
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 94.52
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 94.43
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 94.4
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 94.04
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 93.98
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 93.91
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 93.88
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 93.72
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 93.7
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 93.44
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 93.34
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 93.13
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 92.9
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 92.81
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 92.69
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 92.52
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 92.51
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 92.41
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 91.92
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 91.74
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 91.47
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 91.46
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 91.08
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 91.05
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 90.99
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 90.98
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 90.95
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 90.93
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 90.89
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 90.72
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 90.42
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 90.31
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 90.31
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 89.84
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 89.51
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 89.37
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 89.31
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 88.81
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 88.62
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 88.55
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 88.54
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 86.4
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 85.74
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 85.21
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 84.79
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 84.29
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 83.29
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 82.44
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 81.42
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 81.38
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 81.12
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 80.47
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 80.27
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 80.03
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: dTDP-glucose 4,6-dehydratase (RmlB)
species: Streptomyces venezuelae [TaxId: 54571]
Probab=99.97  E-value=8.1e-30  Score=190.27  Aligned_cols=167  Identities=17%  Similarity=0.181  Sum_probs=137.6

Q ss_pred             CCCchhhhccCCchhhhhHHHHHHHHHHHHHhcCccEEEEcCCCeeCCCCCCCCCchHHHHHHHHcC-Cccc---ccccc
Q 030510            5 CWSDKEYCRTTNNWYCLSKTEAESEALEFAKRTGLDVVTVCPNLIWGPLLQSNVNSSSLVLIKRLKG-YESL---ENRLR   80 (176)
Q Consensus         5 ~~~~~~~~~~~~~~Y~~sK~~~E~~~~~~~~~~~~~~~i~Rp~~v~G~~~~~~~~~~~~~~~~~~~g-~~~~---~~~~~   80 (176)
                      .+.+|+.+..|.+.||.||.++|.+++.++++.+++++++||++||||++... ..+..++.+++.| ....   ++..+
T Consensus       137 ~~~~E~~~~~p~~~Y~~sK~~~E~~~~~~~~~~~~~~~~lR~~~vyGp~~~~~-~~i~~~i~~~~~~~~i~v~~~g~~~r  215 (322)
T d1r6da_         137 GSWTESSPLEPNSPYAASKAGSDLVARAYHRTYGLDVRITRCCNNYGPYQHPE-KLIPLFVTNLLDGGTLPLYGDGANVR  215 (322)
T ss_dssp             SCBCTTSCCCCCSHHHHHHHHHHHHHHHHHHHHCCCEEEEEECEEECTTCCTT-SHHHHHHHHHHTTCCEEEETTSCCEE
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHhCCCEEEEEeeeEECcCCCcC-cHHHHHHHHHHcCCCcEEecCCCeEE
Confidence            34577778889999999999999999999999999999999999999987643 3577788888888 4332   33578


Q ss_pred             ceeeHHHHHHHHHHHhccccCCcceEEe-ccccCHHHHHHHHHHhCCCC-CC---CCCCCCCCCcccCChHHHH-HhCCc
Q 030510           81 MIVDVRDVAEALLLAYEKAEAEGRYICT-AHLIRERDLFDKLKSLYPNY-NY---PKNFTEGREDVTMSSEKLQ-RLGWS  154 (176)
Q Consensus        81 ~~i~v~D~a~a~~~~~~~~~~~~~~~~~-~~~~s~~e~~~~i~~~~~~~-~v---~~~~~~~~~~~~~d~~k~~-~lG~~  154 (176)
                      +|+|++|+|+++..+++++..++.||++ +.++++.|+++.+.+.++.- +.   ..........+.+|++|++ .|||+
T Consensus       216 ~~i~v~D~a~ai~~~~~~~~~~~~~ni~~~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~d~~k~~~~lg~~  295 (322)
T d1r6da_         216 EWVHTDDHCRGIALVLAGGRAGEIYHIGGGLELTNRELTGILLDSLGADWSSVRKVADRKGHDLRYSLDGGKIERELGYR  295 (322)
T ss_dssp             EEEEHHHHHHHHHHHHHHCCTTCEEEECCCCEEEHHHHHHHHHHHHTCCGGGEEEECCCTTCCCBCCBCCHHHHHHHCCC
T ss_pred             ccEEHHHHHHHHHHHHhCCCCCCeeEEeecccchhHHHHHHHHHHhCCCccceeecCCCCCCCceeeeCHHHHHHHHCCC
Confidence            9999999999999999998877777777 78999999999999998632 11   1122233344789999995 79999


Q ss_pred             cc-cHHHHHHHHHHHHHHc
Q 030510          155 FR-PLEETLIDSIESYKKA  172 (176)
Q Consensus       155 p~-~~~~~l~~~~~~~~~~  172 (176)
                      |+ +++|+|+++++||+++
T Consensus       296 p~~~~eegI~~~i~w~~~n  314 (322)
T d1r6da_         296 PQVSFADGLARTVRWYREN  314 (322)
T ss_dssp             CCSCHHHHHHHHHHHHHHC
T ss_pred             CCCCHHHHHHHHHHHHHHh
Confidence            98 9999999999999874



>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure