Citrus Sinensis ID: 030533

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----

MAFSAVTARCPSLLRLPNGHTPSISVNQNSVSFRFSKLNLSRRYSVSVRSSSTSAVAPATEDLKPAILLTEKALKHLSKMRSERSEDLCLRIGVKQGGCSGMSYTMEFENRANARPDDSVIEYDGFVIVCDPKSLLFLFGMQLDYSDALIGGGFSFKNPNATQTCGCGKSFAAEM

ccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccEEEcHHHHHHHHHHHHHcccccEEEEEEEcccccccccccEEEcccccccccEEEECccEEEEEcccccccccccEEEEEccccccccEEccccccccccccccEEECc

******************************************************************ILLTEKALKHLSK*****SEDLCLRIGVKQGGCSGMSYTMEFENRANARPDDSVIEYDGFVIVCDPKSLLFLFGMQLDYSDALIGGGFSFKNPNATQTCGCGKSFAAE*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAFSAVTARCPSLLRLPNGHTPSISVNQNSVSFRFSKLNLSRRYSVSVRSSSTSAVAPATEDLKPAILLTEKALKHLSKMRSERSEDLCLRIGVKQGGCSGMSYTMEFENRANARPDDSVIEYDGFVIVCDPKSLLFLFGMQLDYSDALIGGGFSFKNPNATQTCGCGKSFAAEM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Iron-sulfur assembly protein IscA, chloroplastic	Involved in the assembly of chloroplastic iron-sulfur proteins. Is able to transfer iron-sulfur clusters to apo-ferredoxin.	confident	Q9XIK3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2APN, chain A
Confidence level:very confident
Coverage over the Query: 61-173
View the alignment between query and template
View the model in PyMOL