Citrus Sinensis ID: 030552


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKPQVFKFPSFSLHSKQVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALKDIGPKN
ccccccccccccccccccCEEEEccccccccEEEEccccccccCCccccccccccEEEEEEEcccccccccEEEEEEEECcccCEEEEEEcccccccccCEEEEEEEEEEEccccEEEEEcccccCEEcccccccHHHHHHHHHHHcccccEEEEEEccccEEEEEEEEcccccc
******************TFPQQAGTIRKNGYIVIKNRPCKPQVFKFPSFSLHSKQVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALKDIG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKNRPCKPQVFKFPSFSLHSKQVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDAPHVTRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVTVMSSMGEEQICALKDIGPKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 5A-1 The precise role of eIF-5A in protein biosynthesis is not known but it functions by promoting the formation of the first peptide bond.confidentQ9XI91
Eukaryotic translation initiation factor 5A-2 mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation.probableQ5R898
Eukaryotic translation initiation factor 5A-2 mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation.probableQ9GZV4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HKS, chain A
Confidence level:very confident
Coverage over the Query: 17-41,57-173
View the alignment between query and template
View the model in PyMOL