Citrus Sinensis ID: 030568

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----

MVKYSKEPDNPTKSCKARGSDLRVHFKNTREAAHALRKLSLTKAKRYLEDVMAHKQAIPFTRFCRGVGRTAQAKNRNPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTLSEKEEPVKKEPETQLASRKPRTAT

cccccccccccccEEEEECcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccCEEECccccccccccccccccccccccHHHHHHHHHHHHHHHHHcHccccccccEEEEEEEEccccccccccccccccccccccccccEEEEEECcccccccccHHHHHHccccccc

***************KARGSDLRVHFKNTREAAHALRKLSLTKAKRYLEDVMAHKQAIPFTRFCRGVGRTAQAKNRNPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTLSE**********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVKYSKEPDNPTKSCKARGSDLRVHFKNTREAAHALRKLSLTKAKRYLEDVMAHKQAIPFTRFCRGVGRTAQAKNRNPNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTLSEKEEPVKKEPETQLASRKPRTAT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
60S ribosomal protein L17-1		confident	Q93VI3
60S ribosomal protein L17-2		confident	P51413
60S ribosomal protein L17		probable	P24049

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain r
Confidence level:very confident
Coverage over the Query: 2-154
View the alignment between query and template
View the model in PyMOL