Citrus Sinensis ID: 030573

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MNLVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVVKGLDEGILTMKTGGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEYIPGLEADEE
cccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccEEcccccEEEEEEEccccccccccEEEEEEEEEcccccEEcccccccccEEEEcccccccccHHHHHHccccccEEEEEEccccccccccccccccccccccccEEEEEEEEEccccccccc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcccccEEEEEEcccccccccccEEEEEEEEEEccccEEEEcccccccEEEEcccccccHHHHHHHHHcccccEEEEEEcHHHcccccccccccccccccccEEEEEEEEEEccccccccc
MNLVSRRDLIGLVLGVSTLIldsfdakgaglppeekprlcddACEKelenvpmvttesglqykdikvgqgpsppvgFQVAANYVamipsgqifdsslekgrpyifrvgsgqvvkgldEGILtmktggkrrlyipgplafpkglvsapgrprvapnspvifdvsleyipgleadee
MNLVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVgsgqvvkgldEGILTMKTGGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEYIPGLEADEE
MNLVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVVKGLDEGILTMKTGGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEYIPGLEADEE
******RDLIGLVLGVSTLILDSFDAK*************************MVT***GLQYKDIKVG****PPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVVKGLDEGILTMKTGGKRRLYIPGPLAFPKGLVSA********NSPVIFDVSLEYIP*******
****S***LIGLVLGVSTL***********************************TTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVVKGLDEGILTMKTGGKRRLYIPGPLAFPKGLVSA**RPRVAPNSPVIFDVSLE***G******
MNLVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVVKGLDEGILTMKTGGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEYIPGLEADEE
*NLVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVVKGLDEGILTMKTGGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEYIPGL*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVVKGLDEGILTMKTGGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEYIPGLEADEE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query175 2.2.26 [Sep-21-2011]
O22870223 Peptidyl-prolyl cis-trans yes no 0.994 0.780 0.834 2e-79
Q54NB6364 FK506-binding protein 4 O yes no 0.651 0.313 0.466 3e-21
P0C1B0479 FK506-binding protein 4 O yes no 0.702 0.256 0.390 3e-16
Q4WMV5489 FK506-binding protein 4 O yes no 0.571 0.204 0.424 4e-16
Q9SCY2208 Peptidyl-prolyl cis-trans no no 0.68 0.572 0.398 5e-16
P0C1J6382 FK506-binding protein 4 O N/A no 0.582 0.267 0.420 7e-16
Q6C4C9407 FK506-binding protein 3 O yes no 0.582 0.250 0.425 1e-15
Q2UN37470 FK506-binding protein 4 O yes no 0.577 0.214 0.411 1e-15
Q7SCN0467 FK506-binding protein 4 O N/A no 0.657 0.246 0.403 2e-15
Q6FK71398 FK506-binding protein 4 O yes no 0.657 0.288 0.377 4e-15
>sp|O22870|FK163_ARATH Peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic OS=Arabidopsis thaliana GN=FKBP16-3 PE=1 SV=2 Back     alignment and function desciption
 Score =  294 bits (753), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 160/175 (91%), Gaps = 1/175 (0%)

Query: 2   NLVSRRDLIGLVLGVST-LILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGL 60
           NL SRR+ + LVLGVS  L + S  A  AGLPPE+KPRLC+  CEKELENVPMVTTESGL
Sbjct: 49  NLSSRREAMLLVLGVSGGLSMSSLAAYAAGLPPEDKPRLCEAECEKELENVPMVTTESGL 108

Query: 61  QYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVVKGLDEGI 120
           QYKDIKVG+GPSPPVGFQVAANYVAM+PSGQIFDSSLEKG PY+FRVGSGQV+KGLDEGI
Sbjct: 109 QYKDIKVGRGPSPPVGFQVAANYVAMVPSGQIFDSSLEKGLPYLFRVGSGQVIKGLDEGI 168

Query: 121 LTMKTGGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEYIPGLEADEE 175
           L+MK GGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLE+IPGL+++EE
Sbjct: 169 LSMKAGGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEFIPGLDSEEE 223
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q54NB6|FKBP4_DICDI FK506-binding protein 4 OS=Dictyostelium discoideum GN=fkbp4 PE=1 SV=1 Back     alignment and function description
>sp|P0C1B0|FKBP4_EMENI FK506-binding protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fpr4 PE=3 SV=2 Back     alignment and function description
>sp|Q4WMV5|FKBP4_ASPFU FK506-binding protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fpr4 PE=3 SV=2 Back     alignment and function description
>sp|Q9SCY2|FKB13_ARATH Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic OS=Arabidopsis thaliana GN=FKBP13 PE=1 SV=2 Back     alignment and function description
>sp|P0C1J6|FKBP4_RHIO9 FK506-binding protein 4 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=FKBP4 PE=3 SV=1 Back     alignment and function description
>sp|Q6C4C9|FKBP3_YARLI FK506-binding protein 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FPR3 PE=3 SV=1 Back     alignment and function description
>sp|Q2UN37|FKBP4_ASPOR FK506-binding protein 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fpr4 PE=3 SV=1 Back     alignment and function description
>sp|Q7SCN0|FKBP4_NEUCR FK506-binding protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fpr-4 PE=3 SV=1 Back     alignment and function description
>sp|Q6FK71|FKBP4_CANGA FK506-binding protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FPR4 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
359478215231 PREDICTED: probable FKBP-type peptidyl-p 0.988 0.748 0.872 6e-84
449468858227 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 0.770 0.834 3e-82
356538867232 PREDICTED: probable FKBP-type peptidyl-p 1.0 0.754 0.845 5e-81
357473089226 hypothetical protein MTR_4g068190 [Medic 1.0 0.774 0.846 6e-81
388500658229 unknown [Medicago truncatula] 1.0 0.764 0.846 7e-81
217072022229 unknown [Medicago truncatula] 1.0 0.764 0.840 4e-80
356545409232 PREDICTED: probable FKBP-type peptidyl-p 1.0 0.754 0.840 1e-79
224133380204 predicted protein [Populus trichocarpa] 0.994 0.852 0.848 1e-78
255637694232 unknown [Glycine max] 1.0 0.754 0.828 2e-78
388514693238 unknown [Medicago truncatula] 1.0 0.735 0.829 3e-78
>gi|359478215|ref|XP_002274062.2| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 2, chloroplastic-like [Vitis vinifera] gi|296084250|emb|CBI24638.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  315 bits (806), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 165/173 (95%)

Query: 3   LVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQY 62
           ++ RR+ IGLVLGVS++ +DSFDAK AGLPPE+KPRLCDDACEKELENVPMVTTESGLQY
Sbjct: 59  MLKRREAIGLVLGVSSIFVDSFDAKAAGLPPEDKPRLCDDACEKELENVPMVTTESGLQY 118

Query: 63  KDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVVKGLDEGILT 122
           KDIKVG+GPSPP+GFQVAANYVAM+PSGQIFDSSLEKG+ YIFRVGSGQV+KGLDEGILT
Sbjct: 119 KDIKVGEGPSPPIGFQVAANYVAMVPSGQIFDSSLEKGQLYIFRVGSGQVIKGLDEGILT 178

Query: 123 MKTGGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEYIPGLEADEE 175
           MKTGGKRR+YIPGPLAFPKGL SAPGRPRVA NSPV+FDVSLEYIPGLE DEE
Sbjct: 179 MKTGGKRRIYIPGPLAFPKGLTSAPGRPRVAANSPVVFDVSLEYIPGLEIDEE 231

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449468858|ref|XP_004152138.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic-like [Cucumis sativus] gi|449484749|ref|XP_004156969.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356538867|ref|XP_003537922.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 2, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|357473089|ref|XP_003606829.1| hypothetical protein MTR_4g068190 [Medicago truncatula] gi|355507884|gb|AES89026.1| hypothetical protein MTR_4g068190 [Medicago truncatula] Back     alignment and taxonomy information
>gi|388500658|gb|AFK38395.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|217072022|gb|ACJ84371.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356545409|ref|XP_003541135.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 2, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|224133380|ref|XP_002328028.1| predicted protein [Populus trichocarpa] gi|222837437|gb|EEE75816.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255637694|gb|ACU19170.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388514693|gb|AFK45408.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
TAIR|locus:2058218223 AT2G43560 "AT2G43560" [Arabido 0.994 0.780 0.834 1.2e-74
UNIPROTKB|Q6ZIT9261 OJ1211_G06.16 "Peptidyl-prolyl 0.96 0.643 0.791 2.1e-70
UNIPROTKB|A8IW09208 FKB16-3 "Peptidyl-prolyl cis-t 0.851 0.716 0.624 1.8e-48
DICTYBASE|DDB_G0285357364 DDB_G0285357 "FKBP-type peptid 0.651 0.313 0.466 1e-22
UNIPROTKB|P73037201 ytfC "Peptidyl-prolyl cis-tran 0.845 0.736 0.407 1.3e-22
UNIPROTKB|Q74AS7156 GSU2274 "Peptidyl-prolyl cis-t 0.811 0.910 0.371 9e-22
TIGR_CMR|GSU_2274156 GSU_2274 "FKBP-type peptidyl-p 0.811 0.910 0.371 9e-22
UNIPROTKB|Q7NMC5161 glr0841 "Peptidyl-prolyl cis-t 0.605 0.658 0.454 8e-21
UNIPROTKB|A9WGZ8 237 Caur_0860 "Peptidyl-prolyl cis 0.64 0.472 0.461 1e-20
UNIPROTKB|A8J3L4194 FKB16-2a "Peptidyl-prolyl cis- 0.617 0.556 0.432 2.2e-18
TAIR|locus:2058218 AT2G43560 "AT2G43560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 753 (270.1 bits), Expect = 1.2e-74, P = 1.2e-74
 Identities = 146/175 (83%), Positives = 160/175 (91%)

Query:     2 NLVSRRDLIGLVLGVST-LILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGL 60
             NL SRR+ + LVLGVS  L + S  A  AGLPPE+KPRLC+  CEKELENVPMVTTESGL
Sbjct:    49 NLSSRREAMLLVLGVSGGLSMSSLAAYAAGLPPEDKPRLCEAECEKELENVPMVTTESGL 108

Query:    61 QYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVVKGLDEGI 120
             QYKDIKVG+GPSPPVGFQVAANYVAM+PSGQIFDSSLEKG PY+FRVGSGQV+KGLDEGI
Sbjct:   109 QYKDIKVGRGPSPPVGFQVAANYVAMVPSGQIFDSSLEKGLPYLFRVGSGQVIKGLDEGI 168

Query:   121 LTMKTGGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEYIPGLEADEE 175
             L+MK GGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLE+IPGL+++EE
Sbjct:   169 LSMKAGGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEFIPGLDSEEE 223
GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0006457 "protein folding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009543 "chloroplast thylakoid lumen" evidence=ISS;IDA
GO:0016020 "membrane" evidence=IBA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0015979 "photosynthesis" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019684 "photosynthesis, light reaction" evidence=RCA
UNIPROTKB|Q6ZIT9 OJ1211_G06.16 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8IW09 FKB16-3 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285357 DDB_G0285357 "FKBP-type peptidylprolyl cis-trans isomerase (PPIase)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|P73037 ytfC "Peptidyl-prolyl cis-trans isomerase" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
UNIPROTKB|Q74AS7 GSU2274 "Peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2274 GSU_2274 "FKBP-type peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q7NMC5 glr0841 "Peptidyl-prolyl cis-trans isomerase" [Gloeobacter violaceus PCC 7421 (taxid:251221)] Back     alignment and assigned GO terms
UNIPROTKB|A9WGZ8 Caur_0860 "Peptidyl-prolyl cis-trans isomerase" [Chloroflexus aurantiacus J-10-fl (taxid:324602)] Back     alignment and assigned GO terms
UNIPROTKB|A8J3L4 FKB16-2a "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22870FK163_ARATH5, ., 2, ., 1, ., 80.83420.99420.7802yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 6e-31
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 2e-24
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 2e-16
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 1e-13
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 3e-06
PRK15095156 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis- 0.002
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  110 bits (277), Expect = 6e-31
 Identities = 48/113 (42%), Positives = 66/113 (58%), Gaps = 6/113 (5%)

Query: 52  PMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQ 111
            + T  SGLQYK +K G G +P  G  V  +Y   +  G +FDSS ++G+P  F +  G 
Sbjct: 95  GVKTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLIDGTVFDSSYDRGQPAEFPL--GG 152

Query: 112 VVKGLDEGILTMKTGGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSL 164
           V+ G DEG+  MK GGKR+L IP  LA+  G    PG   + PNS ++F+V L
Sbjct: 153 VIPGWDEGLQGMKVGGKRKLTIPPELAY--GERGVPG--VIPPNSTLVFEVEL 201

Length = 205
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237908 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 175
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 100.0
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.97
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.96
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.96
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.96
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.95
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.95
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.89
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.79
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.76
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.71
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.69
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.26
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 99.26
PRK01490 435 tig trigger factor; Provisional 99.19
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 99.06
KOG0545 329 consensus Aryl-hydrocarbon receptor-interacting pr 98.33
KOG0549 188 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.92
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2e-33  Score=208.02  Aligned_cols=114  Identities=40%  Similarity=0.692  Sum_probs=106.0

Q ss_pred             cCCCceecCCCeEEEEEEcCCCCCCCCCCEEEEEEEEEeCCCcEEecccCCCccEEEEeCCCCcchhHHHHhcCCCCCcE
Q 030573           49 ENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVVKGLDEGILTMKTGGK  128 (175)
Q Consensus        49 ~~~~~~~~~~G~~~~~~~~G~G~~~~~gd~V~v~y~~~~~~g~~~~st~~~~~p~~~~~g~~~~~~g~~~~l~gmk~G~~  128 (175)
                      +.....++++|++|++++.|+|..|..+|.|++||++++.||++||||+++++|+.|.+|  ++|+||.++|.+|++|++
T Consensus        92 k~~~v~~~~sgl~y~~~~~G~G~~~~~~~~V~vhY~G~l~~G~vFDsS~~rg~p~~f~l~--~vI~Gw~egl~~M~vG~k  169 (205)
T COG0545          92 KEKGVKTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLIDGTVFDSSYDRGQPAEFPLG--GVIPGWDEGLQGMKVGGK  169 (205)
T ss_pred             ccCCceECCCCcEEEEEeccCCCCCCCCCEEEEEEEEecCCCCccccccccCCCceeecC--CeeehHHHHHhhCCCCce
Confidence            457789999999999999999999999999999999999999999999999999999999  999999999999999999


Q ss_pred             EEEEecCCCCCCCCCCCCCCCCCCCCCCCeEEEEEEEeec
Q 030573          129 RRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEYIP  168 (175)
Q Consensus       129 ~~~~ip~~~ayg~g~~~~~~~~~ip~~~~l~~~vel~~i~  168 (175)
                      |+++|||++|||  ..+.+  +.||||++|+|+|+|++|+
T Consensus       170 ~~l~IP~~laYG--~~g~~--g~Ippns~LvFeVeLl~v~  205 (205)
T COG0545         170 RKLTIPPELAYG--ERGVP--GVIPPNSTLVFEVELLDVK  205 (205)
T ss_pred             EEEEeCchhccC--cCCCC--CCCCCCCeEEEEEEEEecC
Confidence            999999999994  44443  3499999999999999974

>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-19
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-19
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-19
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 6e-19
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 2e-18
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 3e-18
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-18
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 4e-18
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 4e-17
1u79_A129 Crystal Structure Of Atfkbp13 Length = 129 1e-16
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 1e-13
3jym_A 377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 2e-11
3jxv_A 356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 2e-11
2pbc_A102 Fk506-Binding Protein 2 Length = 102 3e-11
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 4e-11
1kt1_A 457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 6e-11
1jvw_A167 Trypanosoma Cruzi Macrophage Infectivity Potentiato 7e-11
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 1e-10
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 1e-10
1kt0_A 457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 1e-10
1fd9_A213 Crystal Structure Of The Macrophage Infectivity Pot 1e-10
2uz5_A137 Solution Structure Of The Fkbp-Domain Of Legionella 1e-10
3o5d_A 264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 2e-10
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 2e-10
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 3e-10
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 3e-10
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 4e-10
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 4e-10
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 5e-10
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 6e-10
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 7e-10
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 7e-10
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 1e-09
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 1e-09
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 1e-09
1q6u_A245 Crystal Structure Of Fkpa From Escherichia Coli Len 1e-09
1q6h_A224 Crystal Structure Of A Truncated Form Of Fkpa From 2e-09
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 2e-09
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 4e-09
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 4e-09
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 6e-09
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 9e-09
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 1e-08
1q1c_A 280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 1e-08
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 1e-08
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 3e-08
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 4e-08
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 5e-08
3oe2_A219 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Tran 1e-07
2ki3_A126 Structural And Biochemical Characterization Of Fk50 6e-07
1ix5_A151 Solution Structure Of The Methanococcus Thermolitho 3e-06
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 2e-05
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 2e-05
4dip_A125 Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran 3e-05
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure 
Iteration: 1

 Score = 91.3 bits (225), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 76/139 (54%), Gaps = 7/139 (5%)
Query: 29  AGLPPEEKPRLCDDACEKELENV---PMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVA 85
           A   PE+     +D  E   E +    +VTTESGL+Y+D+  G G     G  V+ +Y  
Sbjct: 72  ADQTPEDLDMEDNDIIEAHREQIGGSTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTG 131
Query: 86  MIPSGQIFDSSLEKGRPYIFRVGSGQVVKGLDEGILTMKTGGKRRLYIPGPLAFPKGLVS 145
            +  GQ FDSS ++  P+ F +G G V+KG DEG+  MK GG RRL IP  L +  G   
Sbjct: 132 WLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGY--GARG 189
Query: 146 APGRPRVAPNSPVIFDVSL 164
           A G   + PN+ ++F+V L
Sbjct: 190 AAG--VIPPNATLVFEVEL 206
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Infectivity Potentiator (Tcmip) Length = 167 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1FD9|A Chain A, Crystal Structure Of The Macrophage Infectivity Potentiator Protein (Mip) A Major Virulence Factor From Legionella Pneumophila Length = 213 Back     alignment and structure
>pdb|2UZ5|A Chain A, Solution Structure Of The Fkbp-Domain Of Legionella Pneumophila Mip Length = 137 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|3OE2|A Chain A, 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase Ppiase From Pseudomonas Syringae Pv. Tomato Str. Dc3000 (Pspto Dc3000) Length = 219 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|1IX5|A Chain A, Solution Structure Of The Methanococcus Thermolithotrophicus Fkbp Length = 151 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 3e-39
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 4e-37
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 9e-37
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 2e-35
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 1e-34
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 1e-33
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 2e-33
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 4e-33
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 7e-33
1fd9_A213 Protein (macrophage infectivity potentiator prote; 3e-32
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 6e-32
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 9e-32
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 3e-31
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 4e-31
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 6e-23
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 8e-20
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 7e-31
2ppn_A107 FK506-binding protein 1A; high resolution protein 2e-30
1jvw_A167 Macrophage infectivity potentiator; chagas disease 2e-30
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 6e-30
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-14
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 4e-29
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 2e-28
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-27
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-12
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 7e-27
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 3e-26
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 4e-25
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 5e-25
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-21
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 9e-10
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-07
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 5e-07
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 5e-07
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 6e-07
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 4e-06
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 7e-05
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 1e-04
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 2e-04
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
 Score =  129 bits (325), Expect = 3e-39
 Identities = 48/125 (38%), Positives = 69/125 (55%), Gaps = 7/125 (5%)

Query: 47  ELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFR 106
           E  +     + SGL + D  VG GP    G  + A+YV  + +G++FDSS  +G+P  FR
Sbjct: 1   ETTSCEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFR 60

Query: 107 VGSGQVVKGLDEGIL------TMKTGGKRRLYIPGPLAF-PKGLVSAPGRPRVAPNSPVI 159
           +G G+V+KG D+GIL       M TGGKR L IP  LA+  +G     G   + P S ++
Sbjct: 61  IGVGEVIKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLL 120

Query: 160 FDVSL 164
           FD+  
Sbjct: 121 FDIEY 125
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.97
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.97
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.96
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.96
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.96
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.96
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.96
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.96
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.96
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.96
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.96
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.96
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.96
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.96
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.96
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.96
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.96
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.96
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.95
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.95
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.95
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.94
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.93
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.93
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.91
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.91
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.91
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.9
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.85
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.81
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.81
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.79
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.78
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.77
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.77
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.77
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.72
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.71
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.66
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 99.6
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.47
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.4
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 98.5
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
Probab=99.97  E-value=1.6e-29  Score=174.48  Aligned_cols=111  Identities=37%  Similarity=0.652  Sum_probs=102.0

Q ss_pred             eecCCCeEEEEEEcCCCCC-CCCCCEEEEEEEEEeCCCcEEecccCCCccEEEEeCCCCcchhHHHHhcCCCCCcEEEEE
Q 030573           54 VTTESGLQYKDIKVGQGPS-PPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVVKGLDEGILTMKTGGKRRLY  132 (175)
Q Consensus        54 ~~~~~G~~~~~~~~G~G~~-~~~gd~V~v~y~~~~~~g~~~~st~~~~~p~~~~~g~~~~~~g~~~~l~gmk~G~~~~~~  132 (175)
                      ..+++|++|+++++|+|.. ++.||.|++||++++.||++|+++++.+.|+.|.+|.+++++||+++|.+|++|++++|.
T Consensus         2 ~~~~~g~~~~~~~~G~g~~~~~~gd~V~v~y~~~~~dG~~~d~s~~~~~p~~f~lG~~~~i~g~e~~l~gm~~Ge~~~v~   81 (113)
T 1yat_A            2 EVIEGNVKIDRISPGDGATFPKTGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDVGIPKLSVGEKARLT   81 (113)
T ss_dssp             EECGGGCEEEEEECCCSSCCCCTTCEEEEEEEEEETTSCEEEESTTTTCCEEEETTSSSSCHHHHHHGGGCCTTCEEEEE
T ss_pred             CCCCCCeEEEEEECCCCcccCCCCCEEEEEEEEEECCCCEEEecCCCCCcEEEEeCCCCccHHHHHHHhCCCCCCEEEEE
Confidence            4688999999999999998 999999999999999999999999887789999999999999999999999999999999


Q ss_pred             ecCCCCCCCCCCCCCCCCCCCCCCCeEEEEEEEeec
Q 030573          133 IPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEYIP  168 (175)
Q Consensus       133 ip~~~ayg~g~~~~~~~~~ip~~~~l~~~vel~~i~  168 (175)
                      |||+++||+  .+.  ++.||+|++|+|+|+|++|+
T Consensus        82 ip~~~ayG~--~~~--~~~Ip~~~~l~f~vel~~ik  113 (113)
T 1yat_A           82 IPGPYAYGP--RGF--PGLIPPNSTLVFDVELLKVN  113 (113)
T ss_dssp             ECGGGTTTT--TCB--TTTBCTTCCEEEEEEEEEEC
T ss_pred             ECHHHCcCC--CCC--CCCcCCCCeEEEEEEEEEeC
Confidence            999999954  332  34699999999999999984
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 175
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 2e-22
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-20
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 2e-18
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 8e-18
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 5e-17
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 1e-16
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 2e-16
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 2e-15
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 1e-14
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 2e-13
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 1e-11
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 3e-10
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 2e-08
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 2e-06
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP13
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 84.9 bits (209), Expect = 2e-22
 Identities = 46/119 (38%), Positives = 66/119 (55%), Gaps = 7/119 (5%)

Query: 53  MVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQV 112
              + SGL + D  VG GP    G  + A+YV  + +G++FDSS  +G+P  FR+G G+V
Sbjct: 3   FSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEV 62

Query: 113 VKGLD------EGILTMKTGGKRRLYIPGPLAF-PKGLVSAPGRPRVAPNSPVIFDVSL 164
           +KG D      +GI  M TGGKR L IP  LA+  +G     G   + P S ++FD+  
Sbjct: 63  IKGWDQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEY 121
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.97
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.97
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.97
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.97
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.97
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.97
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.97
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.97
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.96
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.93
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.92
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.76
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.71
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 99.47
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 99.35
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP52, N-terminal domains
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=2e-31  Score=184.06  Aligned_cols=112  Identities=29%  Similarity=0.504  Sum_probs=102.6

Q ss_pred             ecCCCeEEEEEEcCCCCC-CCCCCEEEEEEEEEeCCCcEEecccCCCccEEEEeCCCCcchhHHHHhcCCCCCcEEEEEe
Q 030573           55 TTESGLQYKDIKVGQGPS-PPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVVKGLDEGILTMKTGGKRRLYI  133 (175)
Q Consensus        55 ~~~~G~~~~~~~~G~G~~-~~~gd~V~v~y~~~~~~g~~~~st~~~~~p~~~~~g~~~~~~g~~~~l~gmk~G~~~~~~i  133 (175)
                      ..++|++|+++++|+|.. |..||.|++||++++.||++|++|++++.|+.|.+|.+++++||+++|.+|++|++++|+|
T Consensus         8 ~~d~gv~~~i~~~G~G~~~P~~gd~V~v~y~~~l~dG~~fdss~~~~~p~~f~~g~~~~i~G~~~~l~~M~~Ge~~~~~i   87 (120)
T d1q1ca1           8 KQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITC   87 (120)
T ss_dssp             SCSSSEEEEEEECCSSSCCCCTTCEEEEEEEEEETTSCEEEESTTSSSCEEEETTTTSSCHHHHHHHTTCCTTCEEEEEE
T ss_pred             CCCCCEEEEEEEcccCCcCCCCCCEEEEEEEEEEcCCCEEEeccccccceeeecCCCceeeeeeeeeccccCCcEEEEEE
Confidence            456899999999999965 8999999999999999999999999988999999999999999999999999999999999


Q ss_pred             cCCCCCCCCCCCCCCCCCCCCCCCeEEEEEEEeecCC
Q 030573          134 PGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEYIPGL  170 (175)
Q Consensus       134 p~~~ayg~g~~~~~~~~~ip~~~~l~~~vel~~i~~~  170 (175)
                      ||++|||+  .+.  ++.|||+++|+|+|+|++|+.+
T Consensus        88 p~~laYG~--~g~--~~~IPp~s~LifeIeLl~v~~e  120 (120)
T d1q1ca1          88 KPEYAYGS--AGS--PPKIPPNATLVFEVELFEFKGE  120 (120)
T ss_dssp             CGGGTTTT--TCB--TTTBCTTCCEEEEEEEEEEECE
T ss_pred             CHHHhCCC--cCC--CCCCCcCCcEEEEEEEEEEeCC
Confidence            99999953  333  3579999999999999999763
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure