Citrus Sinensis ID: 030580

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----

MMISNTTRILLPSPPPTCLATRQLDHNPLILRRDQAGFTSRTDFSRKLSHTHNEIFNSKKIISSAQKRGISPPNNRNKTNKKAEVSASARYLHMSAHKVRRVIDQIRGRSYEETLMILELMPYRACYPIFKLIYSAAANGVHNMGFNEASLVIAKAEVNEATSAKRPRPKAQGRE

cccccccccccccccccccccccccccccCEECcccccccccccccccccccccccccHHHHHHHHcccccccccccccccccEEEEEEccccccHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccEEEEEEEEccccccccccccccccc

**********LPSP********QLDHNPLIL****************LSHTHN**********************************SARYLHMSAHKVRRVIDQIRGRSYEETLMILELMPYRACYPIFKLIYSAAANGVHNMGFNEASLVIAKAEVNEATSAKRPRPKAQ***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MMISNTTRILLPSPPPTCLATRQLDHNPLILRRDQAGFTSRTDFSRKLSHTHNEIFNSKKIISSAQKRGISPPNNRNKTNKKAEVSASARYLHMSAHKVRRVIDQIRGRSYEETLMILELMPYRACYPIFKLIYSAAANGVHNMGFNEASLVIAKAEVNEATSAKRPRPKAQGRE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
50S ribosomal protein L22, chloroplastic	The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome.	probable	A4GYV0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain U
Confidence level:very confident
Coverage over the Query: 83-175
View the alignment between query and template
View the model in PyMOL