Citrus Sinensis ID: 030601


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MVYHSSFVDEEGVTKACGCPLLPLKSHIKGPAPASDQDRTDIVDEAITFFRANVFFRNFDIKSSADKLLIYLTFYINVALKRLEGRRTLAEGTKAIINLGLEKVPVPGEPNFPFPGLFALPQSQKEAELFRNYLKQIREETSGRLLSVAYRPNGTPNKWWLAFAKRKFMNIIVP
cccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccccccc
*****S*VDEEGVTKACGCPLLPLKSHIKG*****DQDRTDIVDEAITFFRANVFFRNFDIKSSADKLLIYLTFYINVALKRLEGRRTLAEGTKAIINLGLEKVPVPGEPNFPFPGLFALPQSQKEAELFRNYLKQIREETSGRLLSVAYRPNGTPNKWWLAFAKRKFMNIIV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVYHSSFVDEEGVTKACGCPLLPLKSHIKGPAPASDQDRTDIVDEAITFFRANVFFRNFDIKSSADKLLIYLTFYINVALKRLEGRRTLAEGTKAIINLGLEKVPVPGEPNFPFPGLFALPQSQKEAELFRNYLKQIREETSGRLLSVAYRPNGTPNKWWLAFAKRKFMNIIVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Actin-related protein 2/3 complex subunit 3 Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.probableQ9Y7J4
Actin-related protein 2/3 complex subunit 3 Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.probableQ05933
Actin-related protein 2/3 complex subunit 3 Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament. The Arp2/3 complex is involved in organizing the actin system in cell motility and chemotaxis, in phagocytosis and macropinocytosis, at late steps of endosome processing, and in mitosis. In concert with a group of other proteins, the Arp2/3 complex plays a general role in the rapid activation and adaptation of the actin system to its multiple functions.probableO96624

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DWL, chain E
Confidence level:very confident
Coverage over the Query: 43-80,93-97,137-146,157-171
View the alignment between query and template
View the model in PyMOL