Citrus Sinensis ID: 030636

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----

MARSMEPLVVGRVIGDVVDMFTPATEMTVHYGTKQVANGCEIKPSASADKPSVQIHAPPPASSNLYTLVMVDPDAPSPSEPRYREWLHWIVVDIPEGSDATKELVAYMGPQPPTGIHRYVFALFNQKGKVMAGCRPPDARSNFSTRRFAADNGLQPPVAAVYFNSQKEVAVRKR

ccccccccHcccccccccccccccEEEEEEEccEEEcccccccccccccccEEEECcccccccccEEEEEEccccccccccccccEEEEEEEcccccccccccEEEECcccccccccEEEEEEEEcccccccccccccccccccHHHHHHHccccccEEEEEEEEEEccccccc

*A*SMEPLVVGRVIGDVVDMFTPATEMTVHYGTKQVANGCEIKPSASADKPSVQIHAPPPASSNLYTLVMVDPDAPSPSEPRYREWLHWIVVDIPEGSDATKELVAYMGPQPPTGIHRYVFALFNQKGKVMAGC*****RSNFSTRRFAADNGLQPPVAAVYFNSQKEV*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MARSMEPLVVGRVIGDVVDMFTPATEMTVHYGTKQVANGCEIKPSASADKPSVQIHAPPPASSNLYTLVMVDPDAPSPSEPRYREWLHWIVVDIPEGSDATKELVAYMGPQPPTGIHRYVFALFNQKGKVMAGCRPPDARSNFSTRRFAADNGLQPPVAAVYFNSQKEVAVRKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein MOTHER of FT and TF 1	May form complexes with phosphorylated ligands by interfering with kinases and their effectors.	probable	Q9XFK7
CEN-like protein 1	May form complexes with phosphorylated ligands by interfering with kinases and their effectors.	probable	Q9XH44
CEN-like protein 2	May form complexes with phosphorylated ligands by interfering with kinases and their effectors.	probable	Q9XH43

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WKO, chain A
Confidence level:very confident
Coverage over the Query: 3-168
View the alignment between query and template
View the model in PyMOL