Citrus Sinensis ID: 030638

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----

MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRARTTGAPQNHWFGPSGDPRGAGIGTPEAIKLVWSSHREIIYDYGPVPGNWEIPPST

cHHHHHHHHcccccEEEEccCCcccccccccccccccCEEEEEcHHHHccccccEEEEEECcccEEEEEEccccHHHHHHHHHccccccEEEEEEccHHHHHHHHHHccccCEEEEcccccccccccccccccccccccccccHHHHHHEEEEEEEEEEccccccccccccccc

***HMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRARTTGAPQNHWFGP*****GAGIGTPEAIKLVWSSHREIIYDYGPVPGNW******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLEHMNKLLKVPGSKLLFGGEELKNHSIPSIYGALKPTAVFVPLEEILKDGNYELVTREIFGPFQIVTEYKQDQLPLVLNALERMHAHLTAAVVSNDPLFLQEVIGNTVNGTTYAGLRARTTGAPQNHWFGPSGDPRGAGIGTPEAIKLVWSSHREIIYDYGPVPGNWEIPPST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Delta-1-pyrroline-5-carboxylate dehydrogenase 12A1, mitochondrial	Plays a role in the inhibition of programmed cell death by converting the toxic proline catabolism intermediate (s)-1-pyrroline-5-carboxylate (P5C) to glutamate.	probable	Q8VZC3

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted