Citrus Sinensis ID: 030644


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MLRLGSKRLLRQATAAAVAAPRPVQVAAMPRLYHENVIDHYNNPRNVGSFEKNDATVGTGLVGAPACGDVMKLQIKVDEETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKRTKPSAASEAELPPRAADV
ccccccHHHHHHHHHHHHcccccHccccccHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEEEcccccEEEEEEEcccccHHHHHHHHHHHHHccccHHHHHcccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
****************AVAAPRPVQVAAMPRLYHENVIDHYNNPRNVGSFEKNDATVGTGLVGAPACGDVMKLQIKVDEETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKD***********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRLGSKRLLRQATAAAVAAPRPVQVAAMPRLYHENVIDHYNNPRNVGSFEKNDATVGTGLVGAPACGDVMKLQIKVDEETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKRTKPSAASEAELPPRAADV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Iron-sulfur cluster assembly protein 1 Involved in iron homeostasis within the mitochondrion where it is involved in the assembly of iron-sulfur proteins. Essential for de novo biosynthesis of mitochondrial iron sulfur proteins. Involved in the assembly or repair of the [Fe-S] clusters present in iron-sulfur proteins.confidentO49627
Iron-sulfur cluster assembly enzyme ISCU, mitochondrial Involved in the assembly or repair of the [Fe-S] clusters present in iron-sulfur proteins. Binds iron.probableQ9H1K1
NifU-like protein May be involved in the formation or repair of [Fe-S] clusters present in iron-sulfur proteins.probableP57658

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LVL, chain A
Confidence level:very confident
Coverage over the Query: 32-157
View the alignment between query and template
View the model in PyMOL