Citrus Sinensis ID: 030656


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MFWQIRKMDLEARSLQPNVKAVLLAKLREYKSDLNNLKSEVKRLVSGNLNAAARDELLESGMADALTASADQRSRLMMSTERVNQSTDRIKDSRRTMLETEELGVSILQDLSSQRQSLLHAHNTLHGVDDNVSKSKKVLTAMSRRMSRNKWIIGTVVAVLVIAIILILYFKLAK
cHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MFWQIRKMDL*******NVKAVLLAKLREYKSDLNNLKS**********************************************************LETEELGVSILQD******************DDNVSKSKKVLTAMSRRMSRNKWIIGTVVAVLVIAIILILYFKLAK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFWQIRKMDLEARSLQPNVxxxxxxxxxxxxxxxxxxxxxxxxxxxxNLNAAARDELLESGMADALTASADQRSRLMMSTERVNQSTDRIKDSRRTMLETEELGVSILQDLSSQRQSLLHAHNTLHGVDDNVSKSKKVLTAMSRRMSRNKWIIGTVVAVLVIAIILILYFKLAK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NPS, chain C
Confidence level:confident
Coverage over the Query: 71-148
View the alignment between query and template
View the model in PyMOL
Template: 1VCS, chain A
Confidence level:confident
Coverage over the Query: 2-47
View the alignment between query and template
View the model in PyMOL
Template: 2KOG, chain A
Confidence level:probable
Coverage over the Query: 86-154
View the alignment between query and template
View the model in PyMOL