Citrus Sinensis ID: 030672


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MNTNERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRYKQLILAALSFQFLPNSQPSRLFGDLILFQILQGSLRKRE
ccccccEEEEEEcccHHHHHHHHHHHHHccccccccEEEEEEECcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccHHHHHHHHHHHccccEEEEccccccccccccccccccHHHHHHccccccEEEEccHHHHHHHHcccccc
****ERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRYKQLILAALSFQFLPNSQPSRLFGDLILFQILQGS*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNTNERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRYKQLILAALSFQFLPNSQPSRLFGDLILFQILQGSLRKRE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LOQ, chain A
Confidence level:very confident
Coverage over the Query: 3-48,76-158
View the alignment between query and template
View the model in PyMOL
Template: 3AB8, chain A
Confidence level:very confident
Coverage over the Query: 6-158
View the alignment between query and template
View the model in PyMOL