Citrus Sinensis ID: 030672

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MNTNERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRYKQLILAALSFQFLPNSQPSRLFGDLILFQILQGSLRKRE
ccccccEEEEEEcccHHHHHHHHHHHHHccccccccEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccHHHHHHHHHHHccccEEEEccccccccccccccccccHHHHHHccccccEEEEccHHHHHHHHcccccc
ccccccEEEEEEcccHHHHHHHHHHHHHHcccccccEEEEEEEccccHHHcccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHccccEEEEEEEEEccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHEccccHHHHccccccHHHHHHHHHHHHHHHHcccc
MNTNERRVVVAVDESEESMHALSWCLNnlfspdtnnTLVLLyvkpplpvhssfdaagyifsNDVIKAVEKYASESVNSVMNRAEAVYRNfqnnihvkrvvgcgdakdvICGTVEKLEADTLVMGSHGYGFIKRYKQLILAALSfqflpnsqpsrlfgDLILFQILQGSLRKRE
MNTNERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRYKQLILAALSFQFLPNSQPSRLFGDLILFQILQGSLRKRE
MNTNERRVVVAVDESEESMHALSWCLNNLFSPDTNNTlvllyvkpplpvHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRYKQLILAALSFQFLPNSQPSRLFGDLILFQILQGSLRKRE
******************MHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRYKQLILAALSFQFLPNSQPSRLFGDLILFQILQ*******
***NERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRYKQLILAALSFQFLPNSQPSRLFGDLILFQILQGS*****
********VVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRYKQLILAALSFQFLPNSQPSRLFGDLILFQILQGSLRKRE
****ERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRYKQLILAALSFQFLPNSQPSRLFGDLILFQILQGSLR***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNTNERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRYKQLILAALSFQFLPNSQPSRLFGDLILFQILQGSLRKRE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
255548479161 conserved hypothetical protein [Ricinus 0.751 0.807 0.7 5e-49
224128352164 predicted protein [Populus trichocarpa] 0.751 0.792 0.676 2e-45
118489951179 unknown [Populus trichocarpa x Populus d 0.751 0.726 0.661 1e-44
224068508179 predicted protein [Populus trichocarpa] 0.751 0.726 0.661 1e-44
225437541171 PREDICTED: universal stress protein A-li 0.751 0.760 0.666 3e-44
449469038167 PREDICTED: universal stress protein MJ05 0.739 0.766 0.674 9e-44
147811185171 hypothetical protein VITISV_016798 [Viti 0.728 0.736 0.664 1e-41
15228790162 putative adenine nucleotide alpha hydrol 0.763 0.814 0.606 2e-41
297817586162 universal stress protein family protein 0.763 0.814 0.606 4e-41
357442279158 Universal stress protein A-like protein 0.763 0.835 0.622 6e-41
>gi|255548479|ref|XP_002515296.1| conserved hypothetical protein [Ricinus communis] gi|223545776|gb|EEF47280.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 113/130 (86%)

Query: 4   NERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSND 63
            ER+++VAVDES+ESM ALSWCL NL SP++++TLVLLYVKPP PV+S+FDAAGY+FS D
Sbjct: 8   KERKILVAVDESKESMTALSWCLKNLVSPNSSSTLVLLYVKPPPPVYSAFDAAGYLFSGD 67

Query: 64  VIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVM 123
           VI A+EKY+ + +NSVM RAEAVY+N  +N+ ++RVVG GDAKDVIC +VEKL ADTLVM
Sbjct: 68  VISAMEKYSKDLINSVMERAEAVYKNSISNVKIERVVGSGDAKDVICNSVEKLRADTLVM 127

Query: 124 GSHGYGFIKR 133
           GSH YGF+KR
Sbjct: 128 GSHDYGFLKR 137

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224128352|ref|XP_002320308.1| predicted protein [Populus trichocarpa] gi|118487703|gb|ABK95676.1| unknown [Populus trichocarpa] gi|222861081|gb|EEE98623.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118489951|gb|ABK96772.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|224068508|ref|XP_002302760.1| predicted protein [Populus trichocarpa] gi|222844486|gb|EEE82033.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225437541|ref|XP_002275863.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera] Back     alignment and taxonomy information
>gi|449469038|ref|XP_004152228.1| PREDICTED: universal stress protein MJ0531-like [Cucumis sativus] gi|449524130|ref|XP_004169076.1| PREDICTED: universal stress protein MJ0531-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147811185|emb|CAN63475.1| hypothetical protein VITISV_016798 [Vitis vinifera] Back     alignment and taxonomy information
>gi|15228790|ref|NP_191814.1| putative adenine nucleotide alpha hydrolase domain-containing universal stress protein [Arabidopsis thaliana] gi|14334946|gb|AAK59650.1| unknown protein [Arabidopsis thaliana] gi|16323382|gb|AAL15185.1| unknown protein [Arabidopsis thaliana] gi|332646842|gb|AEE80363.1| putative adenine nucleotide alpha hydrolase domain-containing universal stress protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297817586|ref|XP_002876676.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] gi|297322514|gb|EFH52935.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357442279|ref|XP_003591417.1| Universal stress protein A-like protein [Medicago truncatula] gi|355480465|gb|AES61668.1| Universal stress protein A-like protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
TAIR|locus:2096089162 AT3G62550 "AT3G62550" [Arabido 0.757 0.808 0.526 1.3e-31
TAIR|locus:2043273162 AT2G47710 "AT2G47710" [Arabido 0.710 0.759 0.328 1.7e-11
TAIR|locus:2081531226 AT3G11930 "AT3G11930" [Arabido 0.734 0.561 0.330 2.2e-11
TAIR|locus:2024291171 AT1G09740 "AT1G09740" [Arabido 0.716 0.725 0.348 1.2e-10
TAIR|locus:2076381204 AT3G58450 "AT3G58450" [Arabido 0.751 0.637 0.286 4.1e-10
TAIR|locus:2199282160 AT1G68300 "AT1G68300" [Arabido 0.722 0.781 0.294 8.7e-08
TAIR|locus:2084525160 AT3G53990 "AT3G53990" [Arabido 0.774 0.837 0.25 3.5e-05
TAIR|locus:2086102163 AT3G17020 "AT3G17020" [Arabido 0.797 0.846 0.258 0.00013
TAIR|locus:2200036242 AT1G11360 [Arabidopsis thalian 0.231 0.165 0.425 0.00065
TAIR|locus:2096089 AT3G62550 "AT3G62550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 347 (127.2 bits), Expect = 1.3e-31, P = 1.3e-31
 Identities = 69/131 (52%), Positives = 92/131 (70%)

Query:     3 TNERRVVVAVDESEESMHALSWCLNNLFSPDTNNTXXXXXXXXXXXXHSSFDAAGYIFSN 62
             T ER++VVAVDESEESM ALSW L+NLF   +NNT            +SS DAAG+I + 
Sbjct:     4 TKERKIVVAVDESEESMEALSWSLDNLFPYGSNNTLILLYVKPPLPVYSSLDAAGFIVTG 63

Query:    63 DVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLV 122
             D + A++KY  E V SVM R+  VY++++++I+++R VG GDAK+VIC  V+KL  D LV
Sbjct:    64 DPVAALKKYEYELVESVMARSRTVYQDYESDINIERRVGRGDAKEVICNAVQKLRVDMLV 123

Query:   123 MGSHGYGFIKR 133
             MG+H YGF KR
Sbjct:   124 MGTHDYGFFKR 134
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0005773 "vacuole" evidence=IDA
GO:0002238 "response to molecule of fungal origin" evidence=RCA
TAIR|locus:2043273 AT2G47710 "AT2G47710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081531 AT3G11930 "AT3G11930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024291 AT1G09740 "AT1G09740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076381 AT3G58450 "AT3G58450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199282 AT1G68300 "AT1G68300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084525 AT3G53990 "AT3G53990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086102 AT3G17020 "AT3G17020" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200036 AT1G11360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00140672
SubName- Full=Putative uncharacterized protein; (164 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
cd00293130 cd00293, USP_Like, Usp: Universal stress protein f 2e-16
pfam00582139 pfam00582, Usp, Universal stress protein family 4e-16
cd01989146 cd01989, STK_N, The N-terminal domain of Eukaryoti 4e-08
COG0589154 COG0589, UspA, Universal stress protein UspA and r 2e-05
>gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family Back     alignment and domain information 
 Score = 71.2 bits (175), Expect = 2e-16
 Identities = 37/127 (29%), Positives = 58/127 (45%), Gaps = 18/127 (14%)

Query: 7   RVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIK 66
           R++VAVD SEES  AL W             LVLL+V  P P  ++          ++ +
Sbjct: 1   RILVAVDGSEESERALRWAARLARRLGA--ELVLLHVVDPPPSSAA----------ELAE 48

Query: 67  AVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSH 126
            +E+ A   + ++           +  + V+ VV  GD  + I    E+L AD +VMGS 
Sbjct: 49  LLEEEARALLEALREALA------EAGVKVETVVLEGDPAEAILEAAEELGADLIVMGSR 102

Query: 127 GYGFIKR 133
           G   ++R
Sbjct: 103 GRSGLRR 109

The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity. Length = 130
>gnl|CDD|216006 pfam00582, Usp, Universal stress protein family Back     alignment and domain information
>gnl|CDD|238947 cd01989, STK_N, The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>gnl|CDD|223662 COG0589, UspA, Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 173
PRK15456142 universal stress protein UspG; Provisional 99.94
PRK15005144 universal stress protein F; Provisional 99.94
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 99.93
PRK09982142 universal stress protein UspD; Provisional 99.93
PRK15118144 universal stress global response regulator UspA; P 99.91
PRK10116142 universal stress protein UspC; Provisional 99.9
PF00582140 Usp: Universal stress protein family; InterPro: IP 99.9
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 99.9
cd01987124 USP_OKCHK USP domain is located between the N-term 99.88
PRK11175 305 universal stress protein UspE; Provisional 99.88
cd00293130 USP_Like Usp: Universal stress protein family. The 99.85
PRK11175305 universal stress protein UspE; Provisional 99.83
COG0589154 UspA Universal stress protein UspA and related nuc 99.81
PRK12652 357 putative monovalent cation/H+ antiporter subunit E 99.7
PRK10490 895 sensor protein KdpD; Provisional 99.31
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 99.26
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 98.63
PLN03159 832 cation/H(+) antiporter 15; Provisional 97.74
PLN03159832 cation/H(+) antiporter 15; Provisional 97.31
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 97.24
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 97.06
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 96.8
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 96.22
TIGR00591 454 phr2 photolyase PhrII. All proteins in this family 95.77
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 95.63
PRK12342254 hypothetical protein; Provisional 95.56
COG2086260 FixA Electron transfer flavoprotein, beta subunit 94.9
PF01012164 ETF: Electron transfer flavoprotein domain; InterP 94.88
PRK03359256 putative electron transfer flavoprotein FixA; Revi 94.57
PF00875165 DNA_photolyase: DNA photolyase from Prosite.; Inte 94.51
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 93.99
TIGR02765 429 crypto_DASH cryptochrome, DASH family. Photolyases 92.58
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 92.34
PF02601 319 Exonuc_VII_L: Exonuclease VII, large subunit; Inte 91.48
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 91.28
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 91.25
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 90.72
TIGR03556 471 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 90.59
PRK13820 394 argininosuccinate synthase; Provisional 90.31
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 89.47
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 88.99
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 88.85
PRK00286 438 xseA exodeoxyribonuclease VII large subunit; Revie 88.11
TIGR02039 294 CysD sulfate adenylyltransferase, small subunit. I 88.01
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 87.66
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 87.49
cd01985181 ETF The electron transfer flavoprotein (ETF) serve 87.28
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 85.71
TIGR00237 432 xseA exodeoxyribonuclease VII, large subunit. This 85.31
COG0299200 PurN Folate-dependent phosphoribosylglycinamide fo 85.29
PRK12563 312 sulfate adenylyltransferase subunit 2; Provisional 84.88
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nu 84.84
PRK14664 362 tRNA-specific 2-thiouridylase MnmA; Provisional 84.48
PRK14665 360 mnmA tRNA-specific 2-thiouridylase MnmA; Provision 84.46
cd02072128 Glm_B12_BD B12 binding domain of glutamate mutase 83.97
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 83.76
PRK02261137 methylaspartate mutase subunit S; Provisional 82.24
cd01995169 ExsB ExsB is a transcription regulator related pro 81.52
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 81.47
TIGR02370197 pyl_corrinoid methyltransferase cognate corrinoid 81.44
TIGR01501134 MthylAspMutase methylaspartate mutase, S subunit. 80.28
PRK00109138 Holliday junction resolvase-like protein; Reviewed 80.01
>PRK15456 universal stress protein UspG; Provisional Back     alignment and domain information 
Probab=99.94  E-value=6.1e-26  Score=157.44  Aligned_cols=138  Identities=20%  Similarity=0.195  Sum_probs=107.1

Q ss_pred             CcEEEEEecCCh--HHHHHHHHHHhhcCCCCCCCeEEEEEEeCCCCCCCCcCCCCcccchHHHHHHHHHHHHHHHHHHHH
Q 030672            5 ERRVVVAVDESE--ESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAAGYIFSNDVIKAVEKYASESVNSVMNR   82 (173)
Q Consensus         5 ~~~ILv~vd~s~--~s~~al~~A~~la~~~~~~~~l~~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~   82 (173)
                      |+|||||+|+|+  .+.+|+++|..+|+. .  ++++++||+++.......     .... ......+...+..++.++.
T Consensus         2 ~~~ILv~vD~S~~~~s~~al~~A~~la~~-~--~~l~llhv~~~~~~~~~~-----~~~~-~~~~~~~~~~~~~~~~l~~   72 (142)
T PRK15456          2 YKTIIMPVDVFEMELSDKAVRHAEFLAQD-D--GVIHLLHVLPGSASLSLH-----RFAA-DVRRFEEHLQHEAEERLQT   72 (142)
T ss_pred             CccEEEeccCCchhHHHHHHHHHHHHHhc-C--CeEEEEEEecCccccccc-----cccc-chhhHHHHHHHHHHHHHHH
Confidence            799999999994  899999999999986 5  689999999765321110     0001 1122333444555666666


Q ss_pred             HHHHHHhcCCceEEEEEEeeCChHHHHHHHHhhcCCCEEEEecCCCChhhhhhhhcccchHHHHhcCCCCCeehh
Q 030672           83 AEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRYKQLILAALSFQFLPNSQPSRLFG  157 (173)
Q Consensus        83 ~~~~~~~~~~~v~~~~~~~~g~~~~~I~~~a~~~~~dllV~G~~~~~~~~~~~~~~~gs~~~~ll~~~~~pvL~~  157 (173)
                      +.+.+...+  .++++++..|+|.+.|+++++++++||||||++|++ +.+   .++||++.+++++++||||+.
T Consensus        73 ~~~~~~~~~--~~v~~~v~~G~~~~~I~~~a~~~~~DLIVmG~~g~~-~~~---~llGS~a~~v~~~a~~pVLvV  141 (142)
T PRK15456         73 MVSHFTIDP--SRIKQHVRFGSVRDEVNELAEELGADVVVIGSRNPS-IST---HLLGSNASSVIRHANLPVLVV  141 (142)
T ss_pred             HHHHhCCCC--cceEEEEcCCChHHHHHHHHhhcCCCEEEEcCCCCC-ccc---eecCccHHHHHHcCCCCEEEe
Confidence            666554445  788999999999999999999999999999999976 666   679999999999999999974

>PRK15005 universal stress protein F; Provisional Back     alignment and domain information
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PRK12342 hypothetical protein; Provisional Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>PF00875 DNA_photolyase: DNA photolyase from Prosite Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02765 crypto_DASH cryptochrome, DASH family Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family Back     alignment and domain information
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit Back     alignment and domain information
>PRK00109 Holliday junction resolvase-like protein; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 5e-29
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 1e-26
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 2e-17
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 4e-17
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 1e-16
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 7e-16
2z08_A137 Universal stress protein family; uncharacterized c 8e-16
3s3t_A146 Nucleotide-binding protein, universal stress PROT 2e-15
3fdx_A143 Putative filament protein / universal stress PROT; 6e-14
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 6e-13
3tnj_A150 Universal stress protein (USP); structural genomic 8e-13
3loq_A 294 Universal stress protein; structural genomics, PSI 3e-12
3loq_A294 Universal stress protein; structural genomics, PSI 2e-10
3fg9_A156 Protein of universal stress protein USPA family; A 9e-12
3dlo_A155 Universal stress protein; unknown function, struct 2e-10
3olq_A 319 Universal stress protein E; structural genomics, P 6e-10
3olq_A319 Universal stress protein E; structural genomics, P 1e-09
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 1e-09
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 2e-05
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 6e-09
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 6e-06
1q77_A138 Hypothetical protein AQ_178; structural genomics, 4e-08
3mt0_A290 Uncharacterized protein PA1789; structural genomic 6e-06
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 3e-04
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Length = 175 Back     alignment and structure
 Score =  104 bits (260), Expect = 5e-29
 Identities = 28/138 (20%), Positives = 54/138 (39%), Gaps = 13/138 (9%)

Query: 6   RRVVVAVDESE---------ESMHALSWCLNNLFSP-DTNNTLVLLYVKPPLPVHSSFDA 55
            +V+VAV+ S              A  W L  +     ++  ++LL+V+         D 
Sbjct: 6   TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVV-DEDGFDDV 64

Query: 56  AGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEK 115
                S +  + + +        ++          +  +  +  +  GD KDVIC  V++
Sbjct: 65  DSIYASPEDFRDMRQSNKAKGLHLLEFFVNKCH--EIGVGCEAWIKTGDPKDVICQEVKR 122

Query: 116 LEADTLVMGSHGYGFIKR 133
           +  D LV+GS G G  ++
Sbjct: 123 VRPDFLVVGSRGLGRFQK 140
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Length = 138 Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Length = 162 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Length = 170 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Length = 163 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} Length = 147 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Length = 137 Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} Length = 146 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Length = 143 Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Length = 141 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Length = 150 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Length = 156 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Length = 138 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 99.95
3s3t_A146 Nucleotide-binding protein, universal stress PROT 99.95
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 99.94
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 99.94
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 99.94
3fg9_A156 Protein of universal stress protein USPA family; A 99.93
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 99.93
3dlo_A155 Universal stress protein; unknown function, struct 99.93
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 99.93
2z08_A137 Universal stress protein family; uncharacterized c 99.92
3fdx_A143 Putative filament protein / universal stress PROT; 99.92
3tnj_A150 Universal stress protein (USP); structural genomic 99.91
3olq_A 319 Universal stress protein E; structural genomics, P 99.89
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 99.89
3loq_A 294 Universal stress protein; structural genomics, PSI 99.88
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.87
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.87
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 99.86
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 99.86
1q77_A138 Hypothetical protein AQ_178; structural genomics, 99.85
3loq_A294 Universal stress protein; structural genomics, PSI 99.85
3olq_A319 Universal stress protein E; structural genomics, P 99.84
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.83
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.77
2iel_A138 Hypothetical protein TT0030; TT0030,thermus thermo 96.72
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 96.31
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 96.11
3umv_A 506 Deoxyribodipyrimidine photo-lyase; CPD cyclobutane 94.09
2xry_A 482 Deoxyribodipyrimidine photolyase; DNA damage, DNA 93.88
1zun_A 325 Sulfate adenylyltransferase subunit 2; beta barrel 92.25
3tqr_A215 Phosphoribosylglycinamide formyltransferase; purin 92.23
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alph 92.02
1k92_A 455 Argininosuccinate synthase, argininosuccinate SY; 90.7
3g40_A294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 90.5
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 90.23
3tvs_A 538 Cryptochrome-1; circadian clock light entrainment, 89.78
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 89.14
2der_A 380 TRNA-specific 2-thiouridylase MNMA; protein-RNA co 88.94
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 88.72
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 88.41
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 87.95
2nz2_A 413 Argininosuccinate synthase; amino-acid biosynthesi 87.73
1efp_B252 ETF, protein (electron transfer flavoprotein); ele 87.69
3g40_A 294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 87.56
1o97_C264 Electron transferring flavoprotein beta-subunit; F 87.5
3kcq_A215 Phosphoribosylglycinamide formyltransferase; struc 87.24
3fy4_A 537 6-4 photolyase; DNA repair, clock cryptochrome; HE 87.18
2wq7_A 543 RE11660P; lyase-DNA complex, DNA repair, DNA lesio 87.16
2hma_A 376 Probable tRNA (5-methylaminomethyl-2-thiouridylat 87.01
1efv_B255 Electron transfer flavoprotein; electron transport 86.87
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 86.62
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 86.59
3p9x_A211 Phosphoribosylglycinamide formyltransferase; struc 86.44
1np7_A 489 DNA photolyase; protein with FAD cofactor; HET: DN 86.32
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 85.52
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 84.93
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 84.64
1y80_A210 Predicted cobalamin binding protein; corrinoid, fa 83.37
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 83.06
2j4d_A 525 Cryptochrome 3, cryptochrome DASH; DNA-binding pro 82.83
1owl_A 484 Photolyase, deoxyribodipyrimidine photolyase; DNA 82.62
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 82.22
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 82.17
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 81.86
2e0i_A 440 432AA long hypothetical deoxyribodipyrimidine PHO; 80.87
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 80.77
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate 80.3
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
Probab=99.95  E-value=9.7e-27  Score=163.22  Aligned_cols=150  Identities=18%  Similarity=0.208  Sum_probs=117.6

Q ss_pred             CCCCCcEEEEEecCChHHHHHHHHHHhhcCCCCCCCeEEEEEEeCCC-----CCCCCcCCCCccc-ch--HHHHHHHHHH
Q 030672            1 MNTNERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPL-----PVHSSFDAAGYIF-SN--DVIKAVEKYA   72 (173)
Q Consensus         1 m~~~~~~ILv~vd~s~~s~~al~~A~~la~~~~~~~~l~~l~v~~~~-----~~~~~~~~~~~~~-~~--~~~~~~~~~~   72 (173)
                      |...+++||||+|+|+.+.++++||+.+|+..+  ++|+++||.++.     +.. ......... +.  +......+..
T Consensus         1 M~~~~~~ILv~vD~s~~s~~al~~a~~la~~~~--a~l~ll~v~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~   77 (162)
T 1mjh_A            1 MSVMYKKILYPTDFSETAEIALKHVKAFKTLKA--EEVILLHVIDEREIKKRDIF-SLLLGVAGLNKSVEEFENELKNKL   77 (162)
T ss_dssp             --CCCCEEEEECCSCHHHHHHHHHHHHTCCSSC--CEEEEEEEEEGGGTC------------------CHHHHHHHHHHH
T ss_pred             CccccceEEEEeCCCHHHHHHHHHHHHHHhhcC--CeEEEEEEecCccccccccc-cccccccccccchhhhHHHHHHHH
Confidence            666789999999999999999999999999998  999999998754     110 000000000 11  0122344455


Q ss_pred             HHHHHHHHHHHHHHHHhcCCceEEEEEEeeCChHHHHHHHHhhcCCCEEEEecCCCChhhhhhhhcccchHHHHhcCCCC
Q 030672           73 SESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRYKQLILAALSFQFLPNSQP  152 (173)
Q Consensus        73 ~~~~~~~l~~~~~~~~~~~~~v~~~~~~~~g~~~~~I~~~a~~~~~dllV~G~~~~~~~~~~~~~~~gs~~~~ll~~~~~  152 (173)
                      .+..++.++.+.+.+...|  +++++.+..|++.++|+++++++++||||||+++++++.+   +++||++.+++++++|
T Consensus        78 ~~~~~~~l~~~~~~~~~~g--~~~~~~v~~G~~~~~I~~~a~~~~~dlIV~G~~g~~~~~~---~~~GSv~~~vl~~~~~  152 (162)
T 1mjh_A           78 TEEAKNKMENIKKELEDVG--FKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKE---ILLGSVTENVIKKSNK  152 (162)
T ss_dssp             HHHHHHHHHHHHHHHHHTT--CEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTT---CSSCHHHHHHHHHCCS
T ss_pred             HHHHHHHHHHHHHHHHHcC--CceEEEEcCCCHHHHHHHHHHHcCCCEEEEcCCCCCCccc---eEecchHHHHHHhCCC
Confidence            5677788888888888888  8999999999999999999999999999999999999988   6799999999999999


Q ss_pred             Ceehhh
Q 030672          153 SRLFGD  158 (173)
Q Consensus       153 pvL~~~  158 (173)
                      |||+.+
T Consensus       153 pVlvv~  158 (162)
T 1mjh_A          153 PVLVVK  158 (162)
T ss_dssp             CEEEEC
T ss_pred             CEEEEe
Confidence            999853
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4 Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Back     alignment and structure
>2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 Back     alignment and structure
>3fy4_A 6-4 photolyase; DNA repair, clock cryptochrome; HET: MES FAD; 2.70A {Arabidopsis thaliana} Back     alignment and structure
>2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Back     alignment and structure
>1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica} Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>2j4d_A Cryptochrome 3, cryptochrome DASH; DNA-binding protein, flavoprotein, FAD, mitochondrion, plastid, chromophore, chloroplast; HET: FAD MHF; 1.9A {Arabidopsis thaliana} PDB: 2vtb_A* 2ijg_X* 2vtb_B* Back     alignment and structure
>1owl_A Photolyase, deoxyribodipyrimidine photolyase; DNA repair, flavin enzyme, photoreactivating enzyme; HET: FAD; 1.80A {Synechococcus elongatus} SCOP: a.99.1.1 c.28.1.1 PDB: 1owm_A* 1own_A* 1owo_A* 1owp_A* 1qnf_A* 1tez_A* Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>2e0i_A 432AA long hypothetical deoxyribodipyrimidine PHO; photolyase, FAD, DNA repair, lyase; HET: FAD; 2.80A {Sulfolobus tokodaii} Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 173
d2gm3a1171 c.26.2.4 (A:5-175) Putative ethylene-responsive pr 3e-17
d1mjha_160 c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archa 4e-12
d1tq8a_147 c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobac 7e-10
d1q77a_138 c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex 3e-09
d2z3va1135 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 { 8e-09
d1jmva_140 c.26.2.4 (A:) Universal stress protein A, UspA {Ha 2e-07
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: Putative ethylene-responsive protein AT3g01520/F4P13 7
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 72.6 bits (177), Expect = 3e-17
 Identities = 28/139 (20%), Positives = 51/139 (36%), Gaps = 13/139 (9%)

Query: 6   RRVVVAVDESE---------ESMHALSWCLNNLFSP-DTNNTLVLLYVKPPLPVHSSFDA 55
            +V+VAV+ S              A  W L  +     ++  ++LL+V+         D 
Sbjct: 2   TKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVV-DEDGFDDV 60

Query: 56  AGYIFSNDVIKAVEKYASESVNSVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEK 115
                S +  + + +        ++                   +  GD KDVIC  V++
Sbjct: 61  DSIYASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEA--WIKTGDPKDVICQEVKR 118

Query: 116 LEADTLVMGSHGYGFIKRY 134
           +  D LV+GS G G  ++ 
Sbjct: 119 VRPDFLVVGSRGLGRFQKV 137
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 160 Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 147 Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Length = 138 Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Length = 135 Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 99.96
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 99.94
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 99.94
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 99.93
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 99.9
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 99.89
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 96.81
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 94.95
d3clsc1262 Small, beta subunit of electron transfer flavoprot 94.58
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 94.32
d2j07a2170 DNA photolyase {Thermus thermophilus [TaxId: 274]} 94.14
d1owla2202 DNA photolyase {Synechococcus elongatus [TaxId: 32 94.02
d1efpb_246 Small, beta subunit of electron transfer flavoprot 93.55
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 91.56
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 91.29
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 90.48
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 90.01
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 89.17
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 89.12
d1u3da2185 Cryptochrome {Thale cress (Arabidopsis thaliana) [ 88.84
d3clsd1192 Large, alpha subunit of electron transfer flavopro 86.53
d1vbka1132 Hypothetical protein PH1313, C-terminal domain {Ar 84.9
d3bula2156 Methionine synthase, C-terminal domain {Escherichi 84.01
d1efvb_252 Small, beta subunit of electron transfer flavoprot 83.06
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 81.64
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=99.96  E-value=7.9e-29  Score=172.17  Aligned_cols=146  Identities=17%  Similarity=0.179  Sum_probs=121.9

Q ss_pred             CcEEEEEecCChHHHHHHHHHHhhcCCCCCCCeEEEEEEeCCCCCCCCcCCC-------CcccchHHHHHHHHHHHHHHH
Q 030672            5 ERRVVVAVDESEESMHALSWCLNNLFSPDTNNTLVLLYVKPPLPVHSSFDAA-------GYIFSNDVIKAVEKYASESVN   77 (173)
Q Consensus         5 ~~~ILv~vd~s~~s~~al~~A~~la~~~~~~~~l~~l~v~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~   77 (173)
                      |+|||||+|+|+.+.++++||..+|+..+  ++|+++||.++..........       .....++..........+.++
T Consensus         3 ~~~ILvavD~s~~s~~al~~a~~la~~~~--a~l~llhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (160)
T d1mjha_           3 YKKILYPTDFSETAEIALKHVKAFKTLKA--EEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFENELKNKLTEEAK   80 (160)
T ss_dssp             CCEEEEECCSCHHHHHHHHHHHHTCCSSC--CEEEEEEEEEGGGTC-----------------CHHHHHHHHHHHHHHHH
T ss_pred             cCeEEEEECCCHHHHHHHHHHHHHHHhcC--CEEEEEEecccccccccccccccccccccchhHHHHHHHHHHHHHHHHH
Confidence            69999999999999999999999999999  999999998765432211100       012233445556666677888


Q ss_pred             HHHHHHHHHHHhcCCceEEEEEEeeCChHHHHHHHHhhcCCCEEEEecCCCChhhhhhhhcccchHHHHhcCCCCCeehh
Q 030672           78 SVMNRAEAVYRNFQNNIHVKRVVGCGDAKDVICGTVEKLEADTLVMGSHGYGFIKRYKQLILAALSFQFLPNSQPSRLFG  157 (173)
Q Consensus        78 ~~l~~~~~~~~~~~~~v~~~~~~~~g~~~~~I~~~a~~~~~dllV~G~~~~~~~~~~~~~~~gs~~~~ll~~~~~pvL~~  157 (173)
                      +.++.+.+.+...|  +++++.+..|+|.+.|++++++.++||||||+++++++.+   +++||++++|+++++||||+.
T Consensus        81 ~~l~~~~~~~~~~g--v~~~~~~~~G~~~~~I~~~a~~~~~dliV~G~~~~~~~~~---~~~GS~a~~vl~~s~~pVlvV  155 (160)
T d1mjha_          81 NKMENIKKELEDVG--FKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKE---ILLGSVTENVIKKSNKPVLVV  155 (160)
T ss_dssp             HHHHHHHHHHHHTT--CEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTT---CSSCHHHHHHHHHCCSCEEEE
T ss_pred             HHHHHHHHHHHhcC--CeEEEEEEeccHHHHHhhhhhccccceEEeccCCCCcccc---cccCcHHHHHHhcCCCCEEEE
Confidence            89999999998888  9999999999999999999999999999999999999999   679999999999999999984
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1u3da2 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3clsd1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3bula2 c.23.6.1 (A:741-896) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure