Citrus Sinensis ID: 030694

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLDKPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPSKKSEAVERLGADSFLVSRDQDEMQAAMGTMDGIIDTVSAVHPLMPLIGLLKSQGKLVLLGAPEKPLELPAFPLLTGEEEDSWWQSHWGVEGDSRDD
ccccccEEEEcccccccccccccccccccccHHHHHccccccccEEEEEEcccHHHHHHHHHHHHccEEEEEEcccccHHHHHHHccccEEEEcccHHHHHHHHccccEEEEcccccccHHHHHHcHHcccCEEEEcccccccccccccccccccEEcccccccccccccccc
MVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLDKPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPS****AVERLGADSFLVSRDQDEMQAAMGTMDGIIDTVSAVHPLMPLIGLLKSQGKLVLLGAPEKPLELPAFPLLTGEEEDSWWQSHWG********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLDKPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPSKKSEAVERLGADSFLVSRDQDEMQAAMGTMDGIIDTVSAVHPLMPLIGLLKSQGKLVLLGAPEKPLELPAFPLLTGEEEDSWWQSHWGVEGDSRDD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cinnamyl alcohol dehydrogenase 7 Involved in lignin biosynthesis. Catalyzes the final step specific for the production of lignin monomers. Catalyzes the NADPH-dependent reduction of coniferaldehyde, 5-hydroxyconiferaldehyde, sinapaldehyde, 4-coumaraldehyde and caffeyl aldehyde to their respective alcohols.probableQ02971

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YQD, chain A
Confidence level:very confident
Coverage over the Query: 2-156
View the alignment between query and template
View the model in PyMOL