Citrus Sinensis ID: 030695


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MSRATVELDFFGLENKENSSNKPQFKKFPRQRSFRDIQGAISKINPEIIKSVIASGSAKSSISLPSTPKEEPITFPDVPLYRHIPKSGSENVSETAPLTIFYNGTVAVFDVHREKAEHILKLAVEGNSKSFESNDANVASDQQQQLLETLNTGDLPIARRKSLQRFLEKRKER
cccccEEEEccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEEEccEEEEEcccHHHHHHHHHHHHccccccccccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHccc
***ATVE*DFF********************************INPEIIK********************************************TAPLTIFYNGTVAVFDVHREKAEHILKLAV*************************************SLQR*LEK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRATVELDFFGLENKENSSNKPQFKKFPRQRSFRDIQGAISKINPEIIKSVIASGSAKSSISLPSTPKEEPITFPDVPLYRHIPKSGSENVSETAPLTIFYNGTVAVFDVHREKAEHILKLAVEGNSKSFESNDANVASDQQQQLLETLNTGDLPIARRKSLQRFLEKRKER

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein TIFY 9 Modulator of growth inhibition. Isoform 2, but not isoform 1, confers a strong methyl-jasmonate insensitivity. Not involved in the growth response to salicylic acid or indole-3-acetic acid. May be negatively regulated by the proteasome in an SCF(COI1) E3 ubiquitin-protein ligase complex-dependent manner.probableQ93ZM9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OGL, chain Q
Confidence level:confident
Coverage over the Query: 154-171
View the alignment between query and template
View the model in PyMOL
Template: 2E29, chain A
Confidence level:probable
Coverage over the Query: 94-123
View the alignment between query and template
View the model in PyMOL