Citrus Sinensis ID: 030701

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MASIPCITASIHFVSKPSNSQSSCTKFSSQFLGTKNNLKCFRPSRIGPSNGSRAQCWFKFGKNGVDAENAGIYGSQKRDDFDRDDVEQYFNYMGMLAVEGTYDKMEALLSQNIHPVDILLMLAASEGDKPKIEELLRAGASYTVKDADGRTALERAPSEEIKDLILNFSVQKA
ccccccccccHHccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHccccccccccccccHHHccccHHHHHHHHHHHHHcc
****PCITASIHF*******************GTKNNLKCFR*********SRAQCWFKFGKNGVDAE******SQKRDDFDRDDVEQYFNYMGMLAVEGTYDKMEALLSQNIHPVDILLMLAASEGDKPKIEELLRAGASYTVKDADGRTALERAPSEEIKDLILNFSVQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASIPCITASIHFVSKPSNSQSSCTKFSSQFLGTKNNLKCFRPSRIGPSNGSRAQCWFKFGKNGVDAENAGIYGSQKRDDFDRDDVEQYFNYMGMLAVEGTYDKMEALLSQNIHPVDILLMLAASEGDKPKIEELLRAGASYTVKDADGRTALERAPSEEIKDLILNFSVQKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein LHCP TRANSLOCATION DEFECT Involved in the import of light-harvesting complex proteins (LHCP) and subsequent routing of these proteins to the chloroplast signal recognition particle (SRP) pathway.confidentQ8VY88
Protein LHCP TRANSLOCATION DEFECT Involved in the import of light-harvesting complex proteins (LHCP) and subsequent routing of these proteins to the chloroplast signal recognition particle (SRP) pathway.probableA3BKF2
Protein LHCP TRANSLOCATION DEFECT Involved in the import of light-harvesting complex proteins (LHCP) and subsequent routing of these proteins to the chloroplast signal recognition particle (SRP) pathway.probableA2YLX7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 96-168
View the alignment between query and template
View the model in PyMOL