Citrus Sinensis ID: 030703

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MSRTTDPLAVGRVVGDVVDTFIPSVKMNVIYNSNKQVANGHELMPAVIIAKPRVDIGGEDMRSAYTLIMTDPDAPSPSDPCLREHLHWMVTDIPGTTDASFGKEIVSYETPKPVVGIHRYVFILFKQRGRQTVRPPASRDHFNTRQFSAENGLGLPVAAVYFNAQRETAARRR
cccccccHHcccccccccccccccEEEEEEEccccEEccccEEcccccccccEEEEccccccccEEEEEEcccccccccccccCEEEEEEEcccccccccccCEEEECccccccccccEEEEEEEEcccccccccccccccccHHHHHHHHcccccEEEEEEEEEEccccccc
****TDPLAVGRVVGDVVDTFIPSVKMNVIYNSNKQVANGHELMPAVIIAKPRVDIGGEDMRSAYTLIMTDPDAPSPSDPCLREHLHWMVTDIPGTTDASFGKEIVSYETPKPVVGIHRYVFILFKQRGR********RDHFNTRQFSAENGLGLPVAAVYFNAQR*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRTTDPLAVGRVVGDVVDTFIPSVKMNVIYNSNKQVANGHELMPAVIIAKPRVDIGGEDMRSAYTLIMTDPDAPSPSDPCLREHLHWMVTDIPGTTDASFGKEIVSYETPKPVVGIHRYVFILFKQRGRQTVRPPASRDHFNTRQFSAENGLGLPVAAVYFNAQRETAARRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein BROTHER of FT and TFL 1 May form complexes with phosphorylated ligands by interfering with kinases and their effectors.confidentQ9FIT4
CEN-like protein 1 May form complexes with phosphorylated ligands by interfering with kinases and their effectors.probableQ9XH44
Protein SELF-PRUNING Not known. In plants homozygous for the recessive allele of the SP gene, sympodial segments develop progressively fewer nodes until the shoot is terminated by two consecutive. inflorescences.probableO82088

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WKO, chain A
Confidence level:very confident
Coverage over the Query: 3-167
View the alignment between query and template
View the model in PyMOL