Citrus Sinensis ID: 030705


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MIRLTLTLVLVIGILSSTSQSLRFEIQSAHTKCIAEDIKSNSMTVGKYNVVNPNDGHPLPESHKLTVRVTSAYGNSYHYADRVDSGQFAFTAAEAGDYMACFWAVDHSPQTTVTIDFDWRTGVQAKDWSNVAKKGSVDVMELELKKLYDTVSSIHQEMFYLRERRNAGAEPCY
cHHHHHHHHHHHHHHHHcEEEEEEEEEcccccEEEEEcccccEEEEEEEEEccccccccccccEEEEEEEcccccEEEEEECccccEEEEEECccccEEEEEEEcccccccEEEEEEEEECcccccccccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
**RLTLTLVLVIGILSSTSQSLRFEIQSAHTKCIAEDIKSNSMTVGKYNVVNPNDGHPLPESHKLTVRVTSAYGNSYHYADRVDSGQFAFTAAEAGDYMACFWAVDHSPQTTVTIDFDWRTGVQAKDWSNVAKKGSVDVMELELKKLYDTVSSIHQEMFYLRE**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIRLTLTLVLVIGILSSTSQSLRFEIQSAHTKCIAEDIKSNSMTVGKYNVVNPNDGHPLPESHKLTVRVTSAYGNSYHYADRVDSGQFAFTAAEAGDYMACFWAVDHSPQTTVTIDFDWRTGVQAKDWSNVAKKGSVDVMELELKKLYDTVSSIHQEMFYLRERRNAGAEPCY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transmembrane emp24 domain-containing protein p24delta9 Involved in vesicular protein trafficking. Mainly functions in the early secretory pathway. Thought to act as cargo receptor at the lumenal side for incorporation of secretory cargo molecules into transport vesicles and to be involved in vesicle coat formation at the cytoplasmic side.probableQ9LQY3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OLM, chain A
Confidence level:probable
Coverage over the Query: 23-53,64-123
View the alignment between query and template
View the model in PyMOL
Template: 4B7L, chain A
Confidence level:probable
Coverage over the Query: 2-106
View the alignment between query and template
View the model in PyMOL