Citrus Sinensis ID: 030711

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWFLMKLTNDESEINLANGEADPEFAEWKWASPEEVVEQAVDYKRPTYEEVMRTFRPYLNENGIAAKCKSAKW
cccccccccccEEEEEECccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEEccccccccccHHHHHHHHcccccCEEEEEEEEEEEEEccccccccccccccccccccCEECccHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccc
**GLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWFLMKLTNDESEINLANGEADPEFAEWKWASPEEVVEQAVDYKRPTYEEVMRTFRPYLNENG**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWFLMKLTNDESEINLANGEADPEFAEWKWASPEEVVEQAVDYKRPTYEEVMRTFRPYLNENGIAAKCKSAKW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nudix hydrolase 25 Mediates the hydrolysis of diadenosine 5',5''-P(1)P(4) tetraphosphate (Ap(4)A), a signaling molecule involved in regulation of DNA replication and repair.confidentQ9C6Z2
RNA pyrophosphohydrolase Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.probableA8GW83
RNA pyrophosphohydrolase Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.probableA5E954

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.1.-In phosphorous-containing anhydrides.probable
3.6.1.17Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F3Y, chain A
Confidence level:very confident
Coverage over the Query: 1-158
View the alignment between query and template
View the model in PyMOL