Citrus Sinensis ID: 030711
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 173 | ||||||
| 224108323 | 173 | predicted protein [Populus trichocarpa] | 1.0 | 1.0 | 0.919 | 5e-90 | |
| 224101843 | 173 | predicted protein [Populus trichocarpa] | 1.0 | 1.0 | 0.913 | 2e-89 | |
| 255570126 | 173 | (Di)nucleoside polyphosphate hydrolase, | 1.0 | 1.0 | 0.901 | 2e-88 | |
| 449467617 | 173 | PREDICTED: nudix hydrolase 25-like [Cucu | 1.0 | 1.0 | 0.867 | 3e-85 | |
| 359472870 | 173 | PREDICTED: nudix hydrolase 25-like [Viti | 1.0 | 1.0 | 0.855 | 4e-85 | |
| 351725143 | 173 | uncharacterized protein LOC100306071 [Gl | 1.0 | 1.0 | 0.855 | 2e-84 | |
| 388520493 | 173 | unknown [Lotus japonicus] | 1.0 | 1.0 | 0.855 | 3e-84 | |
| 356530740 | 173 | PREDICTED: nudix hydrolase 25-like [Glyc | 1.0 | 1.0 | 0.855 | 5e-84 | |
| 357438681 | 173 | Nudix hydrolase [Medicago truncatula] gi | 1.0 | 1.0 | 0.855 | 4e-83 | |
| 388501076 | 173 | unknown [Medicago truncatula] | 1.0 | 1.0 | 0.855 | 8e-83 |
| >gi|224108323|ref|XP_002314805.1| predicted protein [Populus trichocarpa] gi|222863845|gb|EEF00976.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 335 bits (858), Expect = 5e-90, Method: Compositional matrix adjust.
Identities = 159/173 (91%), Positives = 167/173 (96%)
Query: 1 MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREET 60
MDGLPSGYRPNVGVCLINSD+ +FVASRLNVPGAWQMPQGGIEDGE+PK AA+REL EET
Sbjct: 1 MDGLPSGYRPNVGVCLINSDNLVFVASRLNVPGAWQMPQGGIEDGEEPKSAAIRELMEET 60
Query: 61 GIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWFLMKLTNDESEINLANGE 120
GIVSAE IAEVPNWLTYDFPPAVK KVNRLWGGEWHGQAQKWFLM+LT DESEINLA+GE
Sbjct: 61 GIVSAETIAEVPNWLTYDFPPAVKAKVNRLWGGEWHGQAQKWFLMRLTKDESEINLASGE 120
Query: 121 ADPEFAEWKWASPEEVVEQAVDYKRPTYEEVMRTFRPYLNENGIAAKCKSAKW 173
ADPEFAEWKWASPEEV+EQAVDYKRPTYEEVMRTFRPYLNENGIAAKCKS+KW
Sbjct: 121 ADPEFAEWKWASPEEVIEQAVDYKRPTYEEVMRTFRPYLNENGIAAKCKSSKW 173
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224101843|ref|XP_002312442.1| predicted protein [Populus trichocarpa] gi|222852262|gb|EEE89809.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255570126|ref|XP_002526025.1| (Di)nucleoside polyphosphate hydrolase, putative [Ricinus communis] gi|223534672|gb|EEF36365.1| (Di)nucleoside polyphosphate hydrolase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449467617|ref|XP_004151519.1| PREDICTED: nudix hydrolase 25-like [Cucumis sativus] gi|449494621|ref|XP_004159600.1| PREDICTED: nudix hydrolase 25-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359472870|ref|XP_002284395.2| PREDICTED: nudix hydrolase 25-like [Vitis vinifera] gi|147845365|emb|CAN79048.1| hypothetical protein VITISV_004867 [Vitis vinifera] gi|297737699|emb|CBI26900.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|351725143|ref|NP_001237082.1| uncharacterized protein LOC100306071 [Glycine max] gi|255627447|gb|ACU14068.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388520493|gb|AFK48308.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|356530740|ref|XP_003533938.1| PREDICTED: nudix hydrolase 25-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357438681|ref|XP_003589617.1| Nudix hydrolase [Medicago truncatula] gi|355478665|gb|AES59868.1| Nudix hydrolase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388501076|gb|AFK38604.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 173 | ||||||
| TAIR|locus:2202487 | 175 | NUDX25 "AT1G30110" [Arabidopsi | 1.0 | 0.988 | 0.828 | 7.6e-80 | |
| TAIR|locus:2075840 | 216 | NUDX26 "AT3G10620" [Arabidopsi | 0.919 | 0.736 | 0.606 | 1.3e-54 | |
| TAIR|locus:2164220 | 227 | NUDX27 "AT5G06340" [Arabidopsi | 0.890 | 0.678 | 0.593 | 1.5e-49 | |
| TIGR_CMR|SPO_3585 | 161 | SPO_3585 "hydrolase, NUDIX fam | 0.849 | 0.913 | 0.451 | 1.2e-33 | |
| UNIPROTKB|Q9KU53 | 172 | rppH "RNA pyrophosphohydrolase | 0.843 | 0.848 | 0.427 | 1.2e-26 | |
| TIGR_CMR|VC_0671 | 172 | VC_0671 "MutT/nudix family pro | 0.843 | 0.848 | 0.427 | 1.2e-26 | |
| UNIPROTKB|Q47Y27 | 171 | rppH "RNA pyrophosphohydrolase | 0.832 | 0.842 | 0.403 | 3.3e-24 | |
| TIGR_CMR|CPS_3625 | 171 | CPS_3625 "(di)nucleoside polyp | 0.832 | 0.842 | 0.403 | 3.3e-24 | |
| UNIPROTKB|P0A776 | 176 | rppH [Escherichia coli K-12 (t | 0.820 | 0.806 | 0.411 | 5.3e-24 | |
| TIGR_CMR|CJE_0684 | 156 | CJE_0684 "(di)nucleoside polyp | 0.809 | 0.897 | 0.381 | 4.8e-23 |
| TAIR|locus:2202487 NUDX25 "AT1G30110" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 802 (287.4 bits), Expect = 7.6e-80, P = 7.6e-80
Identities = 145/175 (82%), Positives = 159/175 (90%)
Query: 1 MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREET 60
M+ LP GYRPNVGVCLINSD+ +FVASRLNVPGAWQMPQGGIEDGEDPK AAMREL+EET
Sbjct: 1 MENLPPGYRPNVGVCLINSDNLVFVASRLNVPGAWQMPQGGIEDGEDPKSAAMRELQEET 60
Query: 61 GIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWFLMKLTNDESE--INLAN 118
G+VSAEI++EVPNWLTYDFPPAVK KVNRLWGGEWHGQAQKW+L++L NDE E INLAN
Sbjct: 61 GVVSAEIVSEVPNWLTYDFPPAVKAKVNRLWGGEWHGQAQKWYLVRLRNDEDEKEINLAN 120
Query: 119 GEADPEFAEWKWASPEEVVEQAVDYKRPTYEEVMRTFRPYLNENGIAAKCKSAKW 173
EAD EFAEWKWA PEEVVEQAVDYKRPTYEEV++TF +LN+ G AAKCKSAKW
Sbjct: 121 NEADSEFAEWKWAKPEEVVEQAVDYKRPTYEEVIKTFGSFLNDTGRAAKCKSAKW 175
|
|
| TAIR|locus:2075840 NUDX26 "AT3G10620" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2164220 NUDX27 "AT5G06340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_3585 SPO_3585 "hydrolase, NUDIX family, NudH subfamily" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KU53 rppH "RNA pyrophosphohydrolase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_0671 VC_0671 "MutT/nudix family protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q47Y27 rppH "RNA pyrophosphohydrolase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_3625 CPS_3625 "(di)nucleoside polyphosphate hydrolase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A776 rppH [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CJE_0684 CJE_0684 "(di)nucleoside polyphosphate hydrolase" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00101050 | hypothetical protein (174 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 173 | |||
| cd03671 | 147 | cd03671, Ap4A_hydrolase_plant_like, Diadenosine te | 9e-72 | |
| PRK00714 | 156 | PRK00714, PRK00714, RNA pyrophosphohydrolase; Revi | 6e-66 | |
| pfam00293 | 133 | pfam00293, NUDIX, NUDIX domain | 3e-20 | |
| COG0494 | 161 | COG0494, MutT, NTP pyrophosphohydrolases including | 4e-15 | |
| cd02883 | 123 | cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup | 1e-14 | |
| cd04664 | 129 | cd04664, Nudix_Hydrolase_7, Members of the Nudix h | 2e-11 | |
| PRK10776 | 129 | PRK10776, PRK10776, nucleoside triphosphate pyroph | 9e-09 | |
| cd03673 | 131 | cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate | 9e-09 | |
| cd03428 | 130 | cd03428, Ap4A_hydrolase_human_like, Diadenosine te | 1e-08 | |
| cd04684 | 128 | cd04684, Nudix_Hydrolase_25, Contains a crystal st | 1e-08 | |
| cd04676 | 129 | cd04676, Nudix_Hydrolase_17, Members of the Nudix | 2e-08 | |
| cd03424 | 137 | cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase | 4e-08 | |
| cd04685 | 133 | cd04685, Nudix_Hydrolase_26, Members of the Nudix | 1e-07 | |
| cd04700 | 142 | cd04700, DR1025_like, DR1025 from Deinococcus radi | 2e-07 | |
| cd03674 | 138 | cd03674, Nudix_Hydrolase_1, Members of the Nudix h | 2e-07 | |
| cd04680 | 120 | cd04680, Nudix_Hydrolase_21, Members of the Nudix | 4e-07 | |
| COG1051 | 145 | COG1051, COG1051, ADP-ribose pyrophosphatase [Nucl | 5e-07 | |
| PRK09438 | 148 | PRK09438, nudB, dihydroneopterin triphosphate pyro | 7e-07 | |
| cd03425 | 124 | cd03425, MutT_pyrophosphohydrolase, The MutT pyrop | 1e-06 | |
| cd04670 | 127 | cd04670, Nudix_Hydrolase_12, Members of the Nudix | 1e-06 | |
| cd04682 | 122 | cd04682, Nudix_Hydrolase_23, Members of the Nudix | 2e-06 | |
| cd04699 | 129 | cd04699, Nudix_Hydrolase_39, Members of the Nudix | 2e-06 | |
| cd04683 | 120 | cd04683, Nudix_Hydrolase_24, Members of the Nudix | 3e-06 | |
| cd04667 | 112 | cd04667, Nudix_Hydrolase_10, Members of the Nudix | 4e-06 | |
| cd04677 | 132 | cd04677, Nudix_Hydrolase_18, Members of the Nudix | 4e-06 | |
| TIGR00586 | 128 | TIGR00586, mutt, mutator mutT protein | 7e-06 | |
| cd04673 | 122 | cd04673, Nudix_Hydrolase_15, Members of the Nudix | 9e-06 | |
| cd04686 | 131 | cd04686, Nudix_Hydrolase_27, Members of the Nudix | 1e-05 | |
| PRK08999 | 312 | PRK08999, PRK08999, hypothetical protein; Provisio | 1e-05 | |
| cd04695 | 131 | cd04695, Nudix_Hydrolase_36, Members of the Nudix | 2e-05 | |
| cd04662 | 126 | cd04662, Nudix_Hydrolase_5, Members of the Nudix h | 3e-05 | |
| cd04681 | 130 | cd04681, Nudix_Hydrolase_22, Members of the Nudix | 4e-05 | |
| cd04690 | 118 | cd04690, Nudix_Hydrolase_31, Members of the Nudix | 6e-05 | |
| COG4119 | 161 | COG4119, COG4119, Predicted NTP pyrophosphohydrola | 7e-05 | |
| cd03427 | 137 | cd03427, MTH1, MutT homolog-1 (MTH1) is a member o | 7e-05 | |
| cd04678 | 129 | cd04678, Nudix_Hydrolase_19, Members of the Nudix | 9e-05 | |
| PRK10546 | 135 | PRK10546, PRK10546, pyrimidine (deoxy)nucleoside t | 1e-04 | |
| cd04669 | 121 | cd04669, Nudix_Hydrolase_11, Members of the Nudix | 1e-04 | |
| PRK15472 | 141 | PRK15472, PRK15472, nucleoside triphosphatase NudI | 2e-04 | |
| cd04663 | 126 | cd04663, Nudix_Hydrolase_6, Members of the Nudix h | 2e-04 | |
| cd04697 | 126 | cd04697, Nudix_Hydrolase_38, Members of the Nudix | 3e-04 | |
| TIGR02705 | 156 | TIGR02705, nudix_YtkD, nucleoside triphosphatase Y | 5e-04 | |
| cd04665 | 118 | cd04665, Nudix_Hydrolase_8, Members of the Nudix h | 6e-04 | |
| cd04666 | 122 | cd04666, Nudix_Hydrolase_9, Members of the Nudix h | 7e-04 | |
| cd04694 | 143 | cd04694, Nudix_Hydrolase_35, Members of the Nudix | 8e-04 | |
| cd04674 | 118 | cd04674, Nudix_Hydrolase_16, Members of the Nudix | 0.001 | |
| cd04691 | 117 | cd04691, Nudix_Hydrolase_32, Members of the Nudix | 0.002 | |
| cd04696 | 125 | cd04696, Nudix_Hydrolase_37, Members of the Nudix | 0.003 | |
| PRK11762 | 185 | PRK11762, nudE, adenosine nucleotide hydrolase Nud | 0.003 | |
| cd04693 | 127 | cd04693, Nudix_Hydrolase_34, Members of the Nudix | 0.003 |
| >gnl|CDD|239643 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
Score = 212 bits (543), Expect = 9e-72
Identities = 84/151 (55%), Positives = 107/151 (70%), Gaps = 6/151 (3%)
Query: 7 GYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGI--VS 64
YRPNVGV L N D ++FV R++ PGAWQ PQGGI++GEDP+ AA+REL EETG+ S
Sbjct: 1 PYRPNVGVVLFNEDGKVFVGRRIDTPGAWQFPQGGIDEGEDPEQAALRELEEETGLDPDS 60
Query: 65 AEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWFLMKLTNDESEINLANGEADPE 124
EIIAE+P+WL YD PP +K K +WGG + GQ QKWFL + T D+SEI+L N PE
Sbjct: 61 VEIIAEIPDWLRYDLPPELKLK---IWGGRYRGQEQKWFLFRFTGDDSEIDL-NAPEHPE 116
Query: 125 FAEWKWASPEEVVEQAVDYKRPTYEEVMRTF 155
F EW+W EE+ + V +KRP YE V++ F
Sbjct: 117 FDEWRWVPLEELPDLIVPFKRPVYEAVLKEF 147
|
Members of this family are well represented in a variety of prokaryotic and eukaryotic organisms. Phylogenetic analysis reveals two distinct subgroups where plant enzymes fall into one group (represented by this subfamily) and fungi/animals/archaea enzymes fall into another. Bacterial enzymes are found in both subfamilies. Ap4A is a potential by-product of aminoacyl tRNA synthesis, and accumulation of Ap4A has been implicated in a range of biological events, such as DNA replication, cellular differentiation, heat shock, metabolic stress, and apoptosis. Ap4A hydrolase cleaves Ap4A asymmetrically into ATP and AMP. It is important in the invasive properties of bacteria and thus presents a potential target for the inhibition of such invasive bacteria. Besides the signature nudix motif (G[X5]E[X7]REUXEEXGU where U is Ile, Leu, or Val), Ap4A hydrolase is structurally similar to the other members of the nudix superfamily with some degree of variations. Several regions in the sequences are poorly defined and substrate and metal binding sites are only predicted based on kinetic studies. Length = 147 |
| >gnl|CDD|234820 PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain | Back alignment and domain information |
|---|
| >gnl|CDD|223568 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240022 cd04664, Nudix_Hydrolase_7, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|182721 PRK10776, PRK10776, nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239645 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239520 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240040 cd04684, Nudix_Hydrolase_25, Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|240032 cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >gnl|CDD|240041 cd04685, Nudix_Hydrolase_26, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240055 cd04700, DR1025_like, DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >gnl|CDD|239646 cd03674, Nudix_Hydrolase_1, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240036 cd04680, Nudix_Hydrolase_21, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|223979 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236516 PRK09438, nudB, dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239517 cd03425, MutT_pyrophosphohydrolase, The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >gnl|CDD|240027 cd04670, Nudix_Hydrolase_12, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240038 cd04682, Nudix_Hydrolase_23, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240054 cd04699, Nudix_Hydrolase_39, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240039 cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240025 cd04667, Nudix_Hydrolase_10, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240033 cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|200031 TIGR00586, mutt, mutator mutT protein | Back alignment and domain information |
|---|
| >gnl|CDD|240030 cd04673, Nudix_Hydrolase_15, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240042 cd04686, Nudix_Hydrolase_27, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|236361 PRK08999, PRK08999, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240051 cd04695, Nudix_Hydrolase_36, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240020 cd04662, Nudix_Hydrolase_5, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240037 cd04681, Nudix_Hydrolase_22, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240046 cd04690, Nudix_Hydrolase_31, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|226604 COG4119, COG4119, Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239519 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240034 cd04678, Nudix_Hydrolase_19, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|182536 PRK10546, PRK10546, pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240026 cd04669, Nudix_Hydrolase_11, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|185369 PRK15472, PRK15472, nucleoside triphosphatase NudI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240021 cd04663, Nudix_Hydrolase_6, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240053 cd04697, Nudix_Hydrolase_38, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|131752 TIGR02705, nudix_YtkD, nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >gnl|CDD|240023 cd04665, Nudix_Hydrolase_8, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240024 cd04666, Nudix_Hydrolase_9, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240050 cd04694, Nudix_Hydrolase_35, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240031 cd04674, Nudix_Hydrolase_16, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240047 cd04691, Nudix_Hydrolase_32, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240052 cd04696, Nudix_Hydrolase_37, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|183303 PRK11762, nudE, adenosine nucleotide hydrolase NudE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240049 cd04693, Nudix_Hydrolase_34, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| cd03671 | 147 | Ap4A_hydrolase_plant_like Diadenosine tetraphospha | 99.93 | |
| PRK00714 | 156 | RNA pyrophosphohydrolase; Reviewed | 99.93 | |
| PRK09438 | 148 | nudB dihydroneopterin triphosphate pyrophosphatase | 99.9 | |
| cd03672 | 145 | Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt | 99.88 | |
| cd04679 | 125 | Nudix_Hydrolase_20 Members of the Nudix hydrolase | 99.86 | |
| cd03424 | 137 | ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) | 99.86 | |
| cd04696 | 125 | Nudix_Hydrolase_37 Members of the Nudix hydrolase | 99.86 | |
| cd03673 | 131 | Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy | 99.86 | |
| PLN02325 | 144 | nudix hydrolase | 99.86 | |
| cd04681 | 130 | Nudix_Hydrolase_22 Members of the Nudix hydrolase | 99.86 | |
| cd04670 | 127 | Nudix_Hydrolase_12 Members of the Nudix hydrolase | 99.85 | |
| cd04700 | 142 | DR1025_like DR1025 from Deinococcus radiodurans, a | 99.85 | |
| PRK15472 | 141 | nucleoside triphosphatase NudI; Provisional | 99.85 | |
| cd03674 | 138 | Nudix_Hydrolase_1 Members of the Nudix hydrolase s | 99.85 | |
| cd03430 | 144 | GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann | 99.85 | |
| PRK15434 | 159 | GDP-mannose mannosyl hydrolase NudD; Provisional | 99.85 | |
| PF00293 | 134 | NUDIX: NUDIX domain; InterPro: IPR000086 The gener | 99.85 | |
| cd04678 | 129 | Nudix_Hydrolase_19 Members of the Nudix hydrolase | 99.84 | |
| cd04680 | 120 | Nudix_Hydrolase_21 Members of the Nudix hydrolase | 99.84 | |
| cd04692 | 144 | Nudix_Hydrolase_33 Members of the Nudix hydrolase | 99.84 | |
| cd02885 | 165 | IPP_Isomerase Isopentenyl diphosphate (IPP) isomer | 99.84 | |
| cd03428 | 130 | Ap4A_hydrolase_human_like Diadenosine tetraphospha | 99.84 | |
| cd04664 | 129 | Nudix_Hydrolase_7 Members of the Nudix hydrolase s | 99.83 | |
| cd04682 | 122 | Nudix_Hydrolase_23 Members of the Nudix hydrolase | 99.83 | |
| cd04677 | 132 | Nudix_Hydrolase_18 Members of the Nudix hydrolase | 99.83 | |
| cd04695 | 131 | Nudix_Hydrolase_36 Members of the Nudix hydrolase | 99.83 | |
| cd03429 | 131 | NADH_pyrophosphatase NADH pyrophosphatase, a membe | 99.83 | |
| cd03675 | 134 | Nudix_Hydrolase_2 Contains a crystal structure of | 99.83 | |
| cd04684 | 128 | Nudix_Hydrolase_25 Contains a crystal structure of | 99.82 | |
| cd04693 | 127 | Nudix_Hydrolase_34 Members of the Nudix hydrolase | 99.82 | |
| PRK15393 | 180 | NUDIX hydrolase YfcD; Provisional | 99.82 | |
| PRK03759 | 184 | isopentenyl-diphosphate delta-isomerase; Provision | 99.82 | |
| cd04697 | 126 | Nudix_Hydrolase_38 Members of the Nudix hydrolase | 99.82 | |
| cd04691 | 117 | Nudix_Hydrolase_32 Members of the Nudix hydrolase | 99.82 | |
| cd04683 | 120 | Nudix_Hydrolase_24 Members of the Nudix hydrolase | 99.82 | |
| cd04673 | 122 | Nudix_Hydrolase_15 Members of the Nudix hydrolase | 99.81 | |
| cd04676 | 129 | Nudix_Hydrolase_17 Members of the Nudix hydrolase | 99.81 | |
| cd04689 | 125 | Nudix_Hydrolase_30 Members of the Nudix hydrolase | 99.81 | |
| cd03426 | 157 | CoAse Coenzyme A pyrophosphatase (CoAse), a member | 99.81 | |
| cd04666 | 122 | Nudix_Hydrolase_9 Members of the Nudix hydrolase s | 99.81 | |
| cd04694 | 143 | Nudix_Hydrolase_35 Members of the Nudix hydrolase | 99.8 | |
| cd04671 | 123 | Nudix_Hydrolase_13 Members of the Nudix hydrolase | 99.8 | |
| cd04687 | 128 | Nudix_Hydrolase_28 Members of the Nudix hydrolase | 99.8 | |
| cd04685 | 133 | Nudix_Hydrolase_26 Members of the Nudix hydrolase | 99.8 | |
| cd04669 | 121 | Nudix_Hydrolase_11 Members of the Nudix hydrolase | 99.8 | |
| COG1051 | 145 | ADP-ribose pyrophosphatase [Nucleotide transport a | 99.8 | |
| cd04688 | 126 | Nudix_Hydrolase_29 Members of the Nudix hydrolase | 99.8 | |
| cd03427 | 137 | MTH1 MutT homolog-1 (MTH1) is a member of the Nudi | 99.8 | |
| cd04672 | 123 | Nudix_Hydrolase_14 Members of the Nudix hydrolase | 99.8 | |
| TIGR02150 | 158 | IPP_isom_1 isopentenyl-diphosphate delta-isomerase | 99.79 | |
| cd04686 | 131 | Nudix_Hydrolase_27 Members of the Nudix hydrolase | 99.79 | |
| cd04667 | 112 | Nudix_Hydrolase_10 Members of the Nudix hydrolase | 99.79 | |
| PRK11762 | 185 | nudE adenosine nucleotide hydrolase NudE; Provisio | 99.79 | |
| cd04690 | 118 | Nudix_Hydrolase_31 Members of the Nudix hydrolase | 99.79 | |
| PRK10546 | 135 | pyrimidine (deoxy)nucleoside triphosphate pyrophos | 99.78 | |
| PRK00241 | 256 | nudC NADH pyrophosphatase; Reviewed | 99.78 | |
| cd04661 | 132 | MRP_L46 Mitochondrial ribosomal protein L46 (MRP L | 99.77 | |
| cd04699 | 129 | Nudix_Hydrolase_39 Members of the Nudix hydrolase | 99.76 | |
| PRK10776 | 129 | nucleoside triphosphate pyrophosphohydrolase; Prov | 99.76 | |
| cd04511 | 130 | Nudix_Hydrolase_4 Members of the Nudix hydrolase s | 99.75 | |
| PRK10729 | 202 | nudF ADP-ribose pyrophosphatase NudF; Provisional | 99.75 | |
| TIGR00052 | 185 | nudix-type nucleoside diphosphatase, YffH/AdpP fam | 99.75 | |
| cd03676 | 180 | Nudix_hydrolase_3 Members of the Nudix hydrolase s | 99.73 | |
| TIGR00586 | 128 | mutt mutator mutT protein. All proteins in this fa | 99.73 | |
| KOG2839 | 145 | consensus Diadenosine and diphosphoinositol polyph | 99.73 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 99.72 | |
| cd03425 | 124 | MutT_pyrophosphohydrolase The MutT pyrophosphohydr | 99.72 | |
| PRK15009 | 191 | GDP-mannose pyrophosphatase NudK; Provisional | 99.71 | |
| cd02883 | 123 | Nudix_Hydrolase Nudix hydrolase is a superfamily o | 99.68 | |
| PRK10707 | 190 | putative NUDIX hydrolase; Provisional | 99.68 | |
| cd04662 | 126 | Nudix_Hydrolase_5 Members of the Nudix hydrolase s | 99.67 | |
| PLN02552 | 247 | isopentenyl-diphosphate delta-isomerase | 99.65 | |
| COG2816 | 279 | NPY1 NTP pyrophosphohydrolases containing a Zn-fin | 99.63 | |
| cd04665 | 118 | Nudix_Hydrolase_8 Members of the Nudix hydrolase s | 99.61 | |
| TIGR02705 | 156 | nudix_YtkD nucleoside triphosphatase YtkD. The fun | 99.61 | |
| PLN02791 | 770 | Nudix hydrolase homolog | 99.61 | |
| PRK08999 | 312 | hypothetical protein; Provisional | 99.61 | |
| cd04674 | 118 | Nudix_Hydrolase_16 Members of the Nudix hydrolase | 99.58 | |
| PLN02709 | 222 | nudix hydrolase | 99.57 | |
| cd04663 | 126 | Nudix_Hydrolase_6 Members of the Nudix hydrolase s | 99.57 | |
| cd03670 | 186 | ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) | 99.56 | |
| KOG3084 | 345 | consensus NADH pyrophosphatase I of the Nudix fami | 99.54 | |
| PLN03143 | 291 | nudix hydrolase; Provisional | 99.5 | |
| COG0494 | 161 | MutT NTP pyrophosphohydrolases including oxidative | 99.42 | |
| COG1443 | 185 | Idi Isopentenyldiphosphate isomerase [Lipid metabo | 99.41 | |
| KOG0648 | 295 | consensus Predicted NUDIX hydrolase FGF-2 and rela | 99.38 | |
| KOG3041 | 225 | consensus Nucleoside diphosphate-sugar hydrolase o | 99.33 | |
| COG4119 | 161 | Predicted NTP pyrophosphohydrolase [DNA replicatio | 99.29 | |
| KOG3069 | 246 | consensus Peroxisomal NUDIX hydrolase [Replication | 99.17 | |
| cd03431 | 118 | DNA_Glycosylase_C DNA glycosylase (MutY in bacteri | 99.09 | |
| PLN02839 | 372 | nudix hydrolase | 98.74 | |
| KOG0142 | 225 | consensus Isopentenyl pyrophosphate:dimethylallyl | 98.73 | |
| PF14815 | 114 | NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 | 98.24 | |
| KOG2937 | 348 | consensus Decapping enzyme complex, predicted pyro | 97.94 | |
| COG4112 | 203 | Predicted phosphoesterase (MutT family) [General f | 97.84 | |
| KOG4195 | 275 | consensus Transient receptor potential-related cha | 97.81 | |
| KOG1689 | 221 | consensus mRNA cleavage factor I subunit [RNA proc | 97.71 | |
| KOG4432 | 405 | consensus Uncharacterized NUDIX family hydrolase [ | 97.54 | |
| PF13869 | 188 | NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B | 97.5 | |
| KOG4313 | 306 | consensus Thiamine pyrophosphokinase [Nucleotide t | 96.92 | |
| KOG4432 | 405 | consensus Uncharacterized NUDIX family hydrolase [ | 96.78 | |
| KOG4548 | 263 | consensus Mitochondrial ribosomal protein L17 [Tra | 96.57 | |
| PRK10880 | 350 | adenine DNA glycosylase; Provisional | 96.51 | |
| PRK13910 | 289 | DNA glycosylase MutY; Provisional | 91.76 | |
| PF14443 | 126 | DBC1: DBC1 | 81.37 |
| >cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
Probab=99.93 E-value=7e-25 Score=151.31 Aligned_cols=141 Identities=56% Similarity=1.160 Sum_probs=99.4
Q ss_pred ccceeEEEEEecCCcEEEEEecCCCCeEECCCcccCCCCCHHHHHHHHHHHHhCCchhh--hhhccCCcccccCCccccc
Q 030711 8 YRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAE--IIAEVPNWLTYDFPPAVKT 85 (173)
Q Consensus 8 ~~~~v~~~i~~~~~~vLl~~r~~~~~~w~lPgG~ie~gE~~~~aa~RE~~EEtGl~~~~--~~~~~~~~~~~~~~~~~~~ 85 (173)
+|.+|++++++.++++||++|...++.|.+|||++++||++.+||+||+.||||+.+.. ++........+.+++....
T Consensus 2 ~~~~v~~ii~~~~~~vLL~~r~~~~~~W~~PgG~~e~gE~~~~aA~REv~EEtGl~~~~~~~l~~~~~~~~y~~~~~~~~ 81 (147)
T cd03671 2 YRPNVGVVLFNEDGKVFVGRRIDTPGAWQFPQGGIDEGEDPEQAALRELEEETGLDPDSVEIIAEIPDWLRYDLPPELKL 81 (147)
T ss_pred CCceEEEEEEeCCCEEEEEEEcCCCCCEECCcCCCCCCcCHHHHHHHHHHHHHCCCcCceEEEEEcCCeeEeeChhhhhc
Confidence 78899999999999999999998668999999999999999999999999999998432 3333333333444332211
Q ss_pred ccccccCCccccceEEEEEEEEccCccccccCCCCCCcccceeeEeCHHHHHHhhhhcCchHHHHHH
Q 030711 86 KVNRLWGGEWHGQAQKWFLMKLTNDESEINLANGEADPEFAEWKWASPEEVVEQAVDYKRPTYEEVM 152 (173)
Q Consensus 86 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~~~~~W~~~~e~~~~~~~~~~~~~~~~~ 152 (173)
+.+.+.+.++..++|++.+.......++.. .+++|+.+++|++++++.+++.++..+++..++
T Consensus 82 ---~~~~~~~~~~~~~~~l~~~~~~~~~~~l~~-~~~~E~~~~~W~~~~el~~~~~~~~~~~~~~~~ 144 (147)
T cd03671 82 ---KIWGGRYRGQEQKWFLFRFTGDDSEIDLNA-PEHPEFDEWRWVPLEELPDLIVPFKRPVYEAVL 144 (147)
T ss_pred ---cccCCcCCCEEEEEEEEEecCCCccccCCC-CCCCCEeeEEeCCHHHHHHhchhhhHHHHHHHH
Confidence 112222344566788888876333333321 124689999999999999998776655554443
|
Members of this family are well represented in a variety of prokaryotic and eukaryotic organisms. Phylogenetic analysis reveals two distinct subgroups where plant enzymes fall into one group (represented by this subfamily) and fungi/animals/archaea enzymes fall into another. Bacterial enzymes are found in both subfamilies. Ap4A is a potential by-product of aminoacyl tRNA synthesis, and accumulation of Ap4A has been implicated in a range of biological events, such as DNA replication, cellular differentiation, heat shock, metabolic stress, and apoptosis. Ap4A hydrolase cleaves Ap4A asymmetrically into ATP and AMP. It is important in the invasive properties of bacteria and thus presents a potential target for the inhibition of such invasive bacteria. Besides the signature nudix motif (G[X5]E[X7]REUXEEXGU where U is Ile, Leu, or Val), Ap4A hydrolase is structurally |
| >PRK00714 RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex | Back alignment and domain information |
|---|
| >cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PLN02325 nudix hydrolase | Back alignment and domain information |
|---|
| >cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >PRK15472 nucleoside triphosphatase NudI; Provisional | Back alignment and domain information |
|---|
| >cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional | Back alignment and domain information |
|---|
| >PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] | Back alignment and domain information |
|---|
| >cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway | Back alignment and domain information |
|---|
| >cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15393 NUDIX hydrolase YfcD; Provisional | Back alignment and domain information |
|---|
| >PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes | Back alignment and domain information |
|---|
| >cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 | Back alignment and domain information |
|---|
| >cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional | Back alignment and domain information |
|---|
| >cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK00241 nudC NADH pyrophosphatase; Reviewed | Back alignment and domain information |
|---|
| >cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional | Back alignment and domain information |
|---|
| >TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family | Back alignment and domain information |
|---|
| >cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR00586 mutt mutator mutT protein | Back alignment and domain information |
|---|
| >KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >PRK15009 GDP-mannose pyrophosphatase NudK; Provisional | Back alignment and domain information |
|---|
| >cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10707 putative NUDIX hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02552 isopentenyl-diphosphate delta-isomerase | Back alignment and domain information |
|---|
| >COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >PLN02791 Nudix hydrolase homolog | Back alignment and domain information |
|---|
| >PRK08999 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02709 nudix hydrolase | Back alignment and domain information |
|---|
| >cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P | Back alignment and domain information |
|---|
| >KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN03143 nudix hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone | Back alignment and domain information |
|---|
| >PLN02839 nudix hydrolase | Back alignment and domain information |
|---|
| >KOG0142 consensus Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A | Back alignment and domain information |
|---|
| >KOG2937 consensus Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A | Back alignment and domain information |
|---|
| >KOG4313 consensus Thiamine pyrophosphokinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4548 consensus Mitochondrial ribosomal protein L17 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10880 adenine DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >PRK13910 DNA glycosylase MutY; Provisional | Back alignment and domain information |
|---|
| >PF14443 DBC1: DBC1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 173 | ||||
| 1f3y_A | 165 | Solution Structure Of The Nudix Enzyme Diadenosine | 2e-57 | ||
| 2kdv_A | 164 | Solution Structure Of Rna Pyrophosphohydrolase Rpph | 2e-23 | ||
| 2kdw_A | 164 | Solution Structure Of Rpph Mutant E53a From Escheri | 7e-23 | ||
| 1sjy_A | 159 | Crystal Structure Of Nudix Hydrolase Dr1025 From De | 5e-06 | ||
| 3oga_A | 165 | 1.75 Angstrom Resolution Crystal Structure Of A Put | 1e-04 | ||
| 3dku_A | 153 | Crystal Structure Of Nudix Hydrolase Orf153, Ymfb, | 2e-04 | ||
| 3hhj_A | 158 | Crystal Structure Of Mutator Mutt From Bartonella H | 4e-04 | ||
| 3r03_A | 144 | The Crystal Structure Of Nudix Hydrolase From Rhodo | 5e-04 | ||
| 3ees_A | 153 | Structure Of The Rna Pyrophosphohydrolase Bdrpph Le | 6e-04 | ||
| 3i7u_A | 134 | Crystal Structure Of Ap4a Hydrolase (Aq_158) From A | 7e-04 | ||
| 2fvv_A | 194 | Human Diphosphoinositol Polyphosphate Phosphohydrol | 7e-04 | ||
| 1v8i_A | 170 | Crystal Structure Analysis Of The Adp-Ribose Pyroph | 9e-04 |
| >pdb|1F3Y|A Chain A, Solution Structure Of The Nudix Enzyme Diadenosine Tetraphosphate Hydrolase From Lupinus Angustifolius L. Length = 165 | Back alignment and structure |
|
| >pdb|2KDV|A Chain A, Solution Structure Of Rna Pyrophosphohydrolase Rpph From Escherichia Coli Length = 164 | Back alignment and structure |
| >pdb|2KDW|A Chain A, Solution Structure Of Rpph Mutant E53a From Escherichia Coli Length = 164 | Back alignment and structure |
| >pdb|1SJY|A Chain A, Crystal Structure Of Nudix Hydrolase Dr1025 From Deinococcus Radiodurans Length = 159 | Back alignment and structure |
| >pdb|3OGA|A Chain A, 1.75 Angstrom Resolution Crystal Structure Of A Putative Ntp Pyrophosphohydrolase (Yfao) From Salmonella Typhimurium Lt2 Length = 165 | Back alignment and structure |
| >pdb|3DKU|A Chain A, Crystal Structure Of Nudix Hydrolase Orf153, Ymfb, From Escherichia Coli K-1 Length = 153 | Back alignment and structure |
| >pdb|3HHJ|A Chain A, Crystal Structure Of Mutator Mutt From Bartonella Henselae Length = 158 | Back alignment and structure |
| >pdb|3R03|A Chain A, The Crystal Structure Of Nudix Hydrolase From Rhodospirillum Rubrum Length = 144 | Back alignment and structure |
| >pdb|3EES|A Chain A, Structure Of The Rna Pyrophosphohydrolase Bdrpph Length = 153 | Back alignment and structure |
| >pdb|3I7U|A Chain A, Crystal Structure Of Ap4a Hydrolase (Aq_158) From Aquifex Aeolicus Vf5 Length = 134 | Back alignment and structure |
| >pdb|2FVV|A Chain A, Human Diphosphoinositol Polyphosphate Phosphohydrolase 1 Length = 194 | Back alignment and structure |
| >pdb|1V8I|A Chain A, Crystal Structure Analysis Of The Adp-Ribose Pyrophosphatase Length = 170 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 173 | |||
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 4e-81 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 5e-73 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 1e-35 | |
| 1xsa_A | 153 | BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, | 6e-30 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 5e-28 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 6e-23 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 1e-17 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 1e-13 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 1e-13 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 2e-13 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 3e-13 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 5e-13 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 2e-12 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 4e-12 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 6e-12 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 8e-12 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 9e-12 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 9e-12 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 2e-11 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 2e-11 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 5e-11 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 6e-11 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 8e-11 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 1e-10 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 3e-10 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 3e-10 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 4e-10 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 5e-10 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 7e-10 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 1e-09 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 2e-09 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 2e-09 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 2e-09 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 5e-09 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 5e-09 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 6e-09 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 8e-09 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 1e-08 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 1e-08 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 3e-08 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 3e-08 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 3e-08 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 5e-08 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 8e-08 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 9e-08 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 1e-07 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 2e-07 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 3e-07 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 8e-07 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 8e-07 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 9e-07 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 1e-06 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 1e-06 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 2e-06 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 1e-05 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 2e-05 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 3e-05 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 2e-04 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 2e-04 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 5e-04 | |
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 6e-04 | |
| 1q33_A | 292 | Pyrophosphatase, ADP-ribose pyrophosphatase; nudix | 9e-04 |
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Length = 165 | Back alignment and structure |
|---|
Score = 236 bits (605), Expect = 4e-81
Identities = 97/160 (60%), Positives = 125/160 (78%), Gaps = 1/160 (0%)
Query: 1 MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREET 60
MD P GYR NVG+CL+N+D +IF ASRL++P AWQMPQGGI++GEDP+ AA+RELREET
Sbjct: 6 MDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREET 65
Query: 61 GIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWFLMKLTNDESEINL-ANG 119
G+ SAE+IAEVP WLTYDFPP V+ K+N WG +W GQAQKWFL K T + EINL +G
Sbjct: 66 GVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGDG 125
Query: 120 EADPEFAEWKWASPEEVVEQAVDYKRPTYEEVMRTFRPYL 159
PEF EW W +PE++++ V++K+P Y+EV+ F P+L
Sbjct: 126 SEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAPHL 165
|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Length = 164 | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Length = 150 | Back alignment and structure |
|---|
| >1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138 | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Length = 149 | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Length = 271 | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160 | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Length = 194 | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153 | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Length = 165 | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153 | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Length = 156 | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Length = 159 | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 364 | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Length = 157 | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Length = 148 | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Length = 154 | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Length = 197 | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171 | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Length = 153 | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Length = 158 | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146 | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} Length = 144 | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} Length = 140 | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Length = 180 | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Length = 140 | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Length = 153 | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Length = 163 | Back alignment and structure |
|---|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Length = 189 | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Length = 129 | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Length = 205 | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Length = 176 | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Length = 206 | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Length = 145 | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Length = 170 | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Length = 139 | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Length = 352 | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Length = 188 | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Length = 198 | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182 | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Length = 171 | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Length = 190 | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Length = 187 | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Length = 161 | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Length = 212 | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Length = 207 | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Length = 155 | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Length = 341 | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Length = 273 | Back alignment and structure |
|---|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Length = 209 | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Length = 300 | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Length = 226 | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Length = 194 | Back alignment and structure |
|---|
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Length = 191 | Back alignment and structure |
|---|
| >1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Length = 292 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 99.96 | |
| 3u53_A | 155 | BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; | 99.92 | |
| 3i7u_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.91 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 99.9 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 99.88 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 99.88 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 99.87 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 99.87 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 99.87 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 99.87 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 99.86 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 99.86 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.86 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 99.85 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 99.85 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 99.85 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 99.85 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 99.85 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 99.85 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 99.84 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 99.84 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 99.84 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 99.84 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 99.84 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 99.83 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 99.83 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 99.83 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 99.83 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 99.83 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 99.83 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 99.83 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 99.82 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 99.82 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 99.82 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 99.82 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 99.82 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 99.82 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 99.82 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 99.82 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 99.81 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 99.81 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 99.81 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 99.81 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 99.81 | |
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 99.81 | |
| 3q91_A | 218 | Uridine diphosphate glucose pyrophosphatase; struc | 99.8 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 99.8 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 99.8 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 99.8 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 99.8 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 99.79 | |
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 99.79 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 99.79 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 99.78 | |
| 3e57_A | 211 | Uncharacterized protein TM1382; structural genomic | 99.78 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 99.78 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 99.78 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 99.78 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 99.78 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 99.77 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 99.77 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 99.76 | |
| 1x51_A | 155 | A/G-specific adenine DNA glycosylase; nudix domain | 99.76 | |
| 2dho_A | 235 | Isopentenyl-diphosphate delta-isomerase 1; alpha/b | 99.74 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 99.74 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 99.73 | |
| 2pny_A | 246 | Isopentenyl-diphosphate delta-isomerase 2; caroten | 99.73 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 99.7 | |
| 1q33_A | 292 | Pyrophosphatase, ADP-ribose pyrophosphatase; nudix | 99.65 | |
| 1u20_A | 212 | U8 snoRNA-binding protein X29; modified nudix hydr | 99.65 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 99.64 | |
| 3fsp_A | 369 | A/G-specific adenine glycosylase; protein-DNA comp | 99.63 | |
| 3qsj_A | 232 | Nudix hydrolase; structural genomics, PSI-biology, | 99.58 | |
| 2xsq_A | 217 | U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp | 99.46 | |
| 3rh7_A | 321 | Hypothetical oxidoreductase; FMN-binding split bar | 99.28 | |
| 3bho_A | 208 | Cleavage and polyadenylation specificity factor su | 99.22 | |
| 3kvh_A | 214 | Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R | 99.01 |
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* | Back alignment and structure |
|---|
Probab=99.96 E-value=8.7e-28 Score=167.10 Aligned_cols=158 Identities=61% Similarity=1.225 Sum_probs=114.6
Q ss_pred CCCCCCCccceeEEEEEecCCcEEEEEecCCCCeEECCCcccCCCCCHHHHHHHHHHHHhCCchhhhhhccCCcccccCC
Q 030711 1 MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEVPNWLTYDFP 80 (173)
Q Consensus 1 m~~~~~~~~~~v~~~i~~~~~~vLl~~r~~~~~~w~lPgG~ie~gE~~~~aa~RE~~EEtGl~~~~~~~~~~~~~~~~~~ 80 (173)
|...+..+|.++++++++.++++||++|...+|.|.+|||++++|||+.+||+||++||||+.+..+......+..+.++
T Consensus 6 ~~~~~~~~~~~v~~~i~~~~~~vLl~~r~~~~g~w~~PgG~ve~gE~~~~aa~RE~~EEtGl~~~~~~~~~~~~~~~~~~ 85 (165)
T 1f3y_A 6 MDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREETGVTSAEVIAEVPYWLTYDFP 85 (165)
T ss_dssp CSSCCSSCCCEEEEEEECTTSCEEEEEETTEEEEEECCEEECCTTCCHHHHHHHHHHHHHCCCSEEEEEECSSCCBCCCC
T ss_pred ccCCccceeeeEEEEEECCCCcEEEEecCCCCCcEECCeeccCCCCCHHHHHHHHHHHhhCCChhhhhcccccceeeecC
Confidence 44445679999999999999999999998767899999999999999999999999999999864443333333455555
Q ss_pred cccccccccccCCccccceEEEEEEEEccCccccccC-CCCCCcccceeeEeCHHHHHHhhhhcCchHHHHHHHHHhhh
Q 030711 81 PAVKTKVNRLWGGEWHGQAQKWFLMKLTNDESEINLA-NGEADPEFAEWKWASPEEVVEQAVDYKRPTYEEVMRTFRPY 158 (173)
Q Consensus 81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~E~~~~~W~~~~e~~~~~~~~~~~~~~~~~~~l~~~ 158 (173)
......+...++..+.+...++|++.+........+. +..+++|+.+++|++++++.+++.+...+.++.+++.|.++
T Consensus 86 ~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~E~~~~~W~~~~el~~~~~~~~~~~~~~~~~~l~~~ 164 (165)
T 1f3y_A 86 PKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGDGSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAPH 164 (165)
T ss_dssp HHHHHHHGGGSCSSCCSCBEEEEEEEECSCGGGCCCCCCSSSCCSEEEEEEECHHHHHHHBCGGGHHHHHHHHHHHGGG
T ss_pred ccccccccccccccccCceEEEEEEEecCCcccccccCCCCCCChhheeEEecHHHHHHHhhhhhHHHHHHHHHHhhhc
Confidence 4433223333334444445678888887654333331 11234689999999999999988765567888887777654
|
| >3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* | Back alignment and structure |
|---|
| >3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A | Back alignment and structure |
|---|
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A | Back alignment and structure |
|---|
| >3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* | Back alignment and structure |
|---|
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* | Back alignment and structure |
|---|
| >3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} | Back alignment and structure |
|---|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 | Back alignment and structure |
|---|
| >2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* | Back alignment and structure |
|---|
| >1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* | Back alignment and structure |
|---|
| >3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A | Back alignment and structure |
|---|
| >3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A | Back alignment and structure |
|---|
| >3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 173 | ||||
| d1jkna_ | 165 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 5e-45 | |
| d1xsba_ | 153 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 2e-16 | |
| d2fvva1 | 135 | d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat | 6e-13 | |
| d2a6ta2 | 151 | d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c | 8e-13 | |
| d1ryaa_ | 160 | d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD | 1e-12 | |
| d1sjya_ | 158 | d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc | 1e-12 | |
| d2b0va1 | 146 | d.113.1.1 (A:4-149) Hypothetical protein NE0184 {N | 5e-12 | |
| d1q33a_ | 292 | d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyr | 8e-11 | |
| d1vcda1 | 126 | d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t | 2e-10 | |
| d2azwa1 | 147 | d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E | 6e-10 | |
| d1irya_ | 156 | d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha | 3e-09 | |
| d1k2ea_ | 152 | d.113.1.1 (A:) Hypothetical protein PAE3301 {Archa | 5e-09 | |
| d1u20a1 | 196 | d.113.1.1 (A:14-209) U8 snorna-binding protein x29 | 6e-09 | |
| d1ktga_ | 137 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 1e-08 | |
| d1hzta_ | 153 | d.113.1.2 (A:) Isopentenyl diphosphate isomerase { | 2e-07 | |
| d1vk6a2 | 131 | d.113.1.4 (A:126-256) NADH pyrophosphatase {Escher | 3e-06 | |
| d2fkba1 | 161 | d.113.1.2 (A:8-168) Hypothetical protein YfcD {Esc | 9e-06 | |
| d2o5fa1 | 162 | d.113.1.2 (A:7-168) Hypothetical protein DR0079 {D | 2e-05 | |
| d2fmla2 | 202 | d.113.1.6 (A:3-204) Hypothetical protein EF2700, N | 4e-05 | |
| d1viua_ | 189 | d.113.1.1 (A:) ADP-ribose pyrophosphatase homologu | 9e-05 | |
| d1g0sa_ | 209 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escheri | 8e-04 | |
| d2b06a1 | 155 | d.113.1.1 (A:1-155) Hypothetical protein SP1235 (s | 9e-04 | |
| d1v8ya_ | 158 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus | 0.002 | |
| d1vhza_ | 186 | d.113.1.1 (A:) ADP compounds hydrolase NudE {Esche | 0.002 |
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Length = 165 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: MutT-like domain: Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) species: Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]
Score = 144 bits (363), Expect = 5e-45
Identities = 96/160 (60%), Positives = 123/160 (76%), Gaps = 1/160 (0%)
Query: 1 MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREET 60
MD P GYR NVG+CL+N+D +IF ASRL++P AWQMPQGGI++GEDP+ AA+RELREET
Sbjct: 6 MDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREET 65
Query: 61 GIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWFLMKLTNDESEINLANGE 120
G+ SAE+IAEVP WLTYDFPP V+ K+N WG +W GQAQKWFL K T + EINL
Sbjct: 66 GVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGDG 125
Query: 121 -ADPEFAEWKWASPEEVVEQAVDYKRPTYEEVMRTFRPYL 159
PEF EW W +PE++++ V++K+P Y+EV+ F P+L
Sbjct: 126 SEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAPHL 165
|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153 | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Length = 160 | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Length = 146 | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126 | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 152 | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 196 | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Length = 137 | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Length = 153 | Back information, alignment and structure |
|---|
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 131 | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Length = 162 | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Length = 202 | Back information, alignment and structure |
|---|
| >d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Length = 189 | Back information, alignment and structure |
|---|
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 209 | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Length = 155 | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Length = 158 | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Length = 186 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| d1jkna_ | 165 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.97 | |
| d1vcda1 | 126 | AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: | 99.91 | |
| d1ktga_ | 137 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.9 | |
| d1sjya_ | 158 | Hypothetical protein DR1025 {Deinococcus radiodura | 99.89 | |
| d2b0va1 | 146 | Hypothetical protein NE0184 {Nitrosomonas europaea | 99.89 | |
| d2fb1a2 | 147 | Hypothetical protein BT0354, N-terminal domain {Ba | 99.89 | |
| d1xsba_ | 153 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.88 | |
| d2a6ta2 | 151 | mRNA decapping enzyme Dcp2p catalytic domain {Schi | 99.88 | |
| d1vk6a2 | 131 | NADH pyrophosphatase {Escherichia coli [TaxId: 562 | 99.88 | |
| d1hzta_ | 153 | Isopentenyl diphosphate isomerase {Escherichia col | 99.88 | |
| d1ryaa_ | 160 | GDP-mannose mannosyl hydrolase NudD {Escherichia c | 99.88 | |
| d2fkba1 | 161 | Hypothetical protein YfcD {Escherichia coli [TaxId | 99.87 | |
| d2fvva1 | 135 | Diphosphoinositol polyphosphate phosphohydrolase { | 99.87 | |
| d1puna_ | 129 | Nucleoside triphosphate pyrophosphorylase (MutT) { | 99.86 | |
| d2o5fa1 | 162 | Hypothetical protein DR0079 {Deinococcus radiodura | 99.85 | |
| d2azwa1 | 147 | Hypothetical protein EF1141 {Enterococcus faecalis | 99.85 | |
| d2b06a1 | 155 | Hypothetical protein SP1235 (spr1115) {Streptococc | 99.84 | |
| d1irya_ | 156 | 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum | 99.84 | |
| d1k2ea_ | 152 | Hypothetical protein PAE3301 {Archaeon Pyrobaculum | 99.83 | |
| d1v8ya_ | 158 | ADP-ribose pyrophosphatase {Thermus thermophilus [ | 99.82 | |
| d1mqea_ | 202 | ADP-ribose pyrophosphatase {Mycobacterium tubercul | 99.82 | |
| d1vhza_ | 186 | ADP compounds hydrolase NudE {Escherichia coli [Ta | 99.81 | |
| d2fmla2 | 202 | Hypothetical protein EF2700, N-terminal domain {En | 99.8 | |
| d1nqza_ | 187 | Coenzyme A pyrophosphatase {Deinococcus radioduran | 99.77 | |
| d1g0sa_ | 209 | ADP-ribose pyrophosphatase {Escherichia coli [TaxI | 99.77 | |
| d1rrqa2 | 127 | Adenine glycosylase MutY, C-terminal domain {Bacil | 99.68 | |
| d1viua_ | 189 | ADP-ribose pyrophosphatase homologue YffH {Escheri | 99.64 | |
| d1q33a_ | 292 | NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { | 99.64 | |
| d1u20a1 | 196 | U8 snorna-binding protein x29 {African clawed frog | 99.58 | |
| d1x51a1 | 142 | A/G-specific adenine DNA glycosylase {Human (Homo | 99.49 |
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: MutT-like domain: Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) species: Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]
Probab=99.97 E-value=1.8e-31 Score=184.85 Aligned_cols=159 Identities=61% Similarity=1.225 Sum_probs=115.3
Q ss_pred CCCCCCCccceeEEEEEecCCcEEEEEecCCCCeEECCCcccCCCCCHHHHHHHHHHHHhCCchhhhhhccCCcccccCC
Q 030711 1 MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEVPNWLTYDFP 80 (173)
Q Consensus 1 m~~~~~~~~~~v~~~i~~~~~~vLl~~r~~~~~~w~lPgG~ie~gE~~~~aa~RE~~EEtGl~~~~~~~~~~~~~~~~~~ 80 (173)
|+..|..||++|+++|+|++++|||++|...+|.|.+|||++|.|||+++||+||++||||+.+..+...........++
T Consensus 6 ~~~~~~~yR~~Vg~vI~n~~~~vLL~kR~~~~g~W~~PgG~ve~gEt~~~Aa~REl~EEtGl~~~~~~~~~~~~~~~~~~ 85 (165)
T d1jkna_ 6 MDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREETGVTSAEVIAEVPYWLTYDFP 85 (165)
T ss_dssp CSSCCSSEEEEEEEEEECTTSCEEEEEESSSTTCEECCEECCCTTCCHHHHHHHHHHHHTCCCSEEEEEECSSCEEEECC
T ss_pred cCCCCCCccccEEEEEEeCCCEEEEEEEcCCCCcccCccceEcCCCChhHHHHHHHHHhhcccccccccccccccccccc
Confidence 66667789999999999999999999999878999999999999999999999999999999964433222222222233
Q ss_pred cccccccccccCCccccceEEEEEEEEccCccccccC-CCCCCcccceeeEeCHHHHHHhhhhcCchHHHHHHHHHhhhh
Q 030711 81 PAVKTKVNRLWGGEWHGQAQKWFLMKLTNDESEINLA-NGEADPEFAEWKWASPEEVVEQAVDYKRPTYEEVMRTFRPYL 159 (173)
Q Consensus 81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~E~~~~~W~~~~e~~~~~~~~~~~~~~~~~~~l~~~~ 159 (173)
..........+...+......+|.+.+.......++. .+.+..|+.+++|++++++.+++.+.+++++.++++.|.+++
T Consensus 86 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~E~~~~~W~~~~el~~~i~~fk~~v~~~~l~~f~p~~ 165 (165)
T d1jkna_ 86 PKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGDGSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAPHL 165 (165)
T ss_dssp HHHHHHHHHHTCCCCSEEEECCEEEEECSCTTTCCSSCSSSSCCCEEEEEEECTTHHHHHSCGGGHHHHHHHHHHTGGGC
T ss_pred ceeeceeeeeecCCccceeeEEEEEEEeCCCceeecCCCCCCCCeeEEeEECCHHHHHHhcchhhHHHHHHHHHHHHhhC
Confidence 2222222223334444445667777776655555542 223445899999999999999887766788888888776653
|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|