Citrus Sinensis ID: 030717


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MKEEQVITSIQCPTRLATIYRLSPLKSFHWKQQLSMELELQKYDTYNVLCLPVSLGFFHAAVSLAQTVDIQKGVSLFRQACIGCHDGGGNVIQPGATLFLKDLQRNGVDTEDEIYHVTYFGKGRMPGFGEKCTPRGQCTFGARLQDEDIKLLAQFVKSQADQGWPKIESMED
cccHHHHHHccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcHHHcccccccccccccccHHHHHHcccccHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccc
****QVI*SIQCPTRLATIYRLSPLKSFHWKQQLSMELELQKYDTYNVLCLPVSLGFFHAAVSLAQTVDIQKGVSLFRQACIGCHDGGGNVIQPGATLFLKDLQRNGVDTEDEIYHVTYFGKGRMPGFGEKCTPRGQCTFGARLQDEDIKLLAQFVKSQAD***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEEQVITSIQCPTRLATIYRLSPLKSFHWKQQLSMELELQKYDTYNVLCLPVSLGFFHAAVSLAQTVDIQKGVSLFRQACIGCHDGGGNVIQPGATLFLKDLQRNGVDTEDEIYHVTYFGKGRMPGFGEKCTPRGQCTFGARLQDEDIKLLAQFVKSQADQGWPKIESMED

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome c6, chloroplastic Functions as an electron carrier between membrane-bound cytochrome b6-f and photosystem I in oxygenic photosynthesis.probableQ93VA3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CE0, chain A
Confidence level:very confident
Coverage over the Query: 68-166
View the alignment between query and template
View the model in PyMOL
Template: 3VRD, chain A
Confidence level:confident
Coverage over the Query: 38-129,142-160
View the alignment between query and template
View the model in PyMOL