Citrus Sinensis ID: 030731


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MSYGLPVMIYSFQLDAVIEAEKQAARDLIRQKRKDRALLALKKKKAQEELLKQVDGWLINVEQQLADIELASKQKAVFESLKSGTNAIKAIQSEINLEDVQKLMDDTEEAKAYQDEINAILGEKLSAEDEEEILAEFDNLEAQVFAYIQFELAHNFYYSVLPFPHFSLSKQF
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc
***GLPVMIYSFQLDAVIEAEKQAARDLI*******ALLALKKKKAQEELLKQVDGWLINVEQQLADIELASKQKAVFESLKSGTNAIKAIQSEINLEDVQKLMDDTEEAKAYQDEINAILGEKLSAEDEEEILAEFDNLEAQVFAYIQFELAHNFYYSVLPFPH*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYGLPVMIYSFQLDAVIEAEKQAARDLxxxxxxxxxxxxxxxxxxxxxLLKQVDGWLINVEQQLADIELASKQKAVFESLKSGTNAIKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEEILAEFDNLEAQVFAYIQFELAHNFYYSVLPFPHFSLSKQF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar protein sorting-associated protein 20 homolog 2 Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-III complex is probably involved in the concentration of MVB cargo.probableQ9FY89

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ABM, chain A
Confidence level:confident
Coverage over the Query: 2-69
View the alignment between query and template
View the model in PyMOL
Template: 3FRT, chain A
Confidence level:confident
Coverage over the Query: 6-119
View the alignment between query and template
View the model in PyMOL