Citrus Sinensis ID: 030741

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--

MAAITSVSQLHSSLSSLYPNYRSSPLILAPKTNQDTTICCLTVRSFTFSRRRLSSQSVPRGLIIQNAATKPAKSPAEEDWKTKRELLLQKRVRSVEAKEALRLQKENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWDIARRAAFAFFGIFSGTEENPEFLQSIAS

ccccHHHHHcccccccccccccccccccccccccccccCEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHccccEEEEcccHHHHHHccccccCEEccEEccccccHHHHHHHHHHHHHcccccccccHHHHHHHHc

************************************TICCLTVRSFTFSRRRLSSQSVPRGLII*******************RELLLQKRVRSVEAKEALRLQKENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWDIARRAAFAFFGIFSGTEENPEFLQSI**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAAITSVSQLHSSLSSLYPNYRSSPLILAPKTNQDTTICCLTVRSFTFSRRRLSSQSVPRGLIIQNAATKPAKSPAEEDWKTKRELLLQKRVRSVEAKEALRLQKENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWDIARRAAFAFFGIFSGTEENPEFLQSIAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Rhodanese-like domain-containing protein 14, chloroplastic		probable	Q94A65

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YT8, chain A
Confidence level:very confident
Coverage over the Query: 22-140
View the alignment between query and template
View the model in PyMOL