Citrus Sinensis ID: 030741

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MAAITSVSQLHSSLSSLYPNYRSSPLILAPKTNQDTTICCLTVRSFTFSRRRLSSQSVPRGLIIQNAATKPAKSPAEEDWKTKRELLLQKRVRSVEAKEALRLQKENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWDIARRAAFAFFGIFSGTEENPEFLQSIAS
ccccHHHHHcccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHccccEEEEcccHHHHHHccccccEEEccEEccccccHHHHHHHHHHHHHcccccccccHHHHHHHHc
ccEEEEEcHHHHccccccccccccccccccccccccccccEEEEEcccccccHHHcccccEEEEccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHccEEEEEcccHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHHHHHccccccHHHHHHHcc
MAAITSVSQLHSSLsslypnyrssplilapktnqdtticcltvrsftfsrrrlssqsvprgliiqnaatkpakspaeedWKTKRELLLQKRVRSVEAKEALRLQKennfvildvrpeaefkeahppgaiNVQIYRLIKEWTAWDIARRAAFAFFgifsgteenpEFLQSIAS
MAAITSVSQLHSSLSSLYPNYRSSPLIlapktnqdttICCLTVRSFTfsrrrlssqsvprgliiqnaatkpakspaeedwkTKRELLLQKRVRSVEAkealrlqkennfviLDVRpeaefkeahppgaiNVQIYRLIKEWTAWDIARRAAFAFFGIFSGTEENPEFLQSIAS
MAAITsvsqlhsslsslYPNYRSSPLILAPKTNQDTTICCltvrsftfsrrrlssQSVPRGLIIQNAATKPAKSPAEEDWKTKRELLLQKRVRSVEAKEALRLQKENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWDiarraafaffgifSGTEENPEFLQSIAS
************************PLILAPKTNQDTTICCLTVRSFTFSRR***********I************************************ALRLQKENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWDIARRAAFAFFGIFSG*************
*************************************ICCLTVRSFTFSRRRLSSQSVPRGLII*******************RELLLQKRVRSVEAKEALRLQKENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWDIARRAAFAFFGIFSGTEENPEFLQSI**
**************SSLYPNYRSSPLILAPKTNQDTTICCLTVRSFTFSRRRLSSQSVPRGLIIQNA*************KTKRELLLQKRVRSVEAKEALRLQKENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWDIARRAAFAFFGIFSGTEENPEFLQSIAS
*AAITSVSQLHSSLSSL*******************TICCLTVRSFTFSRRRLSSQSVPRGLIIQNAATKPAKSPAEEDWKTKRELLLQKRVRSVEAKEALRLQKENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWDIARRAAFAFFGIFSGTEENPEFLQSIA*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooo
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAITSVSQLHSSLSSLYPNYRSSPLILAPKTNQDTTICCLTVRSFTFSRRRLSSQSVPRGLIIQNAATKPAKSPAEEDWKTKRELLLQKRVRSVEAKEALRLQKENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWDIARRAAFAFFGIFSGTEENPEFLQSIAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query172 2.2.26 [Sep-21-2011]
Q94A65224 Rhodanese-like domain-con yes no 0.877 0.674 0.616 3e-48
O48529 234 Rhodanese-like domain-con no no 0.511 0.376 0.293 0.0004
>sp|Q94A65|STR14_ARATH Rhodanese-like domain-containing protein 14, chloroplastic OS=Arabidopsis thaliana GN=At4g27700 PE=2 SV=1 Back     alignment and function desciption
 Score =  190 bits (483), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/159 (61%), Positives = 117/159 (73%), Gaps = 8/159 (5%)

Query: 12  SSLSSLYPNYRSSPLILAPKTNQDTTICCLTVRSFTFSRRRLSSQSVPRGLIIQNAATKP 71
           +SL+S+   Y SS   L  K++ +T         F+   R  +  S  + L IQ  +TKP
Sbjct: 2   ASLTSIATPYPSSSQALRLKSSGNTL--------FSAGVRSAAMVSGHKTLKIQCTSTKP 53

Query: 72  AKSPAEEDWKTKRELLLQKRVRSVEAKEALRLQKENNFVILDVRPEAEFKEAHPPGAINV 131
           AK  AE DW+ KRELLL+KRVRSV+ KEA RLQKENNFVILDVRPEAE+K  HPPGAINV
Sbjct: 54  AKPAAEVDWRQKRELLLEKRVRSVDVKEAQRLQKENNFVILDVRPEAEYKAGHPPGAINV 113

Query: 132 QIYRLIKEWTAWDIARRAAFAFFGIFSGTEENPEFLQSI 170
           ++YRLI+EWTAWDIARR  FAFFGIFSGTEENPEF+QS+
Sbjct: 114 EMYRLIREWTAWDIARRLGFAFFGIFSGTEENPEFIQSV 152

Arabidopsis thaliana (taxid: 3702)
>sp|O48529|STR9_ARATH Rhodanese-like domain-containing protein 9, chloroplastic OS=Arabidopsis thaliana GN=STR9 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
449457001237 PREDICTED: rhodanese-like domain-contain 0.982 0.713 0.732 2e-64
224135067239 predicted protein [Populus trichocarpa] 0.906 0.652 0.794 2e-58
224118370239 predicted protein [Populus trichocarpa] 0.906 0.652 0.762 1e-55
224118366184 predicted protein [Populus trichocarpa] 0.889 0.831 0.784 1e-55
217071574232 unknown [Medicago truncatula] 0.843 0.625 0.712 2e-54
357464053232 Senescence-associated protein DIN1 [Medi 0.843 0.625 0.712 2e-54
356552743235 PREDICTED: uncharacterized protein LOC10 0.924 0.676 0.695 2e-54
255588548235 conserved hypothetical protein [Ricinus 0.808 0.591 0.764 4e-52
225455288233 PREDICTED: uncharacterized protein LOC10 0.959 0.708 0.703 4e-52
357464055248 Senescence-associated protein DIN1 [Medi 0.872 0.604 0.613 3e-51
>gi|449457001|ref|XP_004146237.1| PREDICTED: rhodanese-like domain-containing protein 14, chloroplastic-like [Cucumis sativus] gi|449515971|ref|XP_004165021.1| PREDICTED: rhodanese-like domain-containing protein 14, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 138/172 (80%), Gaps = 3/172 (1%)

Query: 1   MAAITSVSQLHSSLSSLYPNYRSSPLILAPKTNQDTTICCLTVRSFTFSRRRLSSQSVPR 60
           MAA  S   L  + SSL+P  + SPL+ + K   D +  C TVRS  +  ++ SSQS PR
Sbjct: 1   MAAFAS---LPLTSSSLHPVVQFSPLVFSSKVVYDPSSYCFTVRSIRYGNQKFSSQSNPR 57

Query: 61  GLIIQNAATKPAKSPAEEDWKTKRELLLQKRVRSVEAKEALRLQKENNFVILDVRPEAEF 120
            LII  AATK AK+PAEEDWK KRELLLQKRVRSV+A EALRLQKENNFVILDVRPEAEF
Sbjct: 58  SLIILGAATKQAKTPAEEDWKVKRELLLQKRVRSVDANEALRLQKENNFVILDVRPEAEF 117

Query: 121 KEAHPPGAINVQIYRLIKEWTAWDIARRAAFAFFGIFSGTEENPEFLQSIAS 172
           KE HPPGAINVQIYRLIKEWTAWDIARRAAFAFFGIFSGTEENPEFLQS+ S
Sbjct: 118 KEGHPPGAINVQIYRLIKEWTAWDIARRAAFAFFGIFSGTEENPEFLQSVES 169

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224135067|ref|XP_002321975.1| predicted protein [Populus trichocarpa] gi|222868971|gb|EEF06102.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224118370|ref|XP_002317802.1| predicted protein [Populus trichocarpa] gi|118489060|gb|ABK96337.1| unknown [Populus trichocarpa x Populus deltoides] gi|222858475|gb|EEE96022.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224118366|ref|XP_002317801.1| predicted protein [Populus trichocarpa] gi|222858474|gb|EEE96021.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|217071574|gb|ACJ84147.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357464053|ref|XP_003602308.1| Senescence-associated protein DIN1 [Medicago truncatula] gi|355491356|gb|AES72559.1| Senescence-associated protein DIN1 [Medicago truncatula] gi|388515773|gb|AFK45948.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356552743|ref|XP_003544722.1| PREDICTED: uncharacterized protein LOC100792221 [Glycine max] Back     alignment and taxonomy information
>gi|255588548|ref|XP_002534640.1| conserved hypothetical protein [Ricinus communis] gi|223524858|gb|EEF27743.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|225455288|ref|XP_002274646.1| PREDICTED: uncharacterized protein LOC100245212 [Vitis vinifera] gi|302143949|emb|CBI23054.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357464055|ref|XP_003602309.1| Senescence-associated protein DIN1 [Medicago truncatula] gi|355491357|gb|AES72560.1| Senescence-associated protein DIN1 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
TAIR|locus:2137792224 AT4G27700 "AT4G27700" [Arabido 0.633 0.486 0.688 4.4e-36
TAIR|locus:2097628214 AT3G08920 "AT3G08920" [Arabido 0.296 0.238 0.372 0.00012
TAIR|locus:2137792 AT4G27700 "AT4G27700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 389 (142.0 bits), Expect = 4.4e-36, P = 4.4e-36
 Identities = 75/109 (68%), Positives = 85/109 (77%)

Query:    62 LIIQNAATKPAKSPAEEDWKTKRELLLQKRVRSVEAKEALRLQKENNFVILDVRPEAEFK 121
             L IQ  +TKPAK  AE DW+ KRELLL+KRVRSV+ KEA RLQKENNFVILDVRPEAE+K
Sbjct:    44 LKIQCTSTKPAKPAAEVDWRQKRELLLEKRVRSVDVKEAQRLQKENNFVILDVRPEAEYK 103

Query:   122 EAHPPGAINVQIYRLIKEWTAWDXXXXXXXXXXXXXSGTEENPEFLQSI 170
               HPPGAINV++YRLI+EWTAWD             SGTEENPEF+QS+
Sbjct:   104 AGHPPGAINVEMYRLIREWTAWDIARRLGFAFFGIFSGTEENPEFIQSV 152
GO:0003674 "molecular_function" evidence=ND
GO:0007568 "aging" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA
TAIR|locus:2097628 AT3G08920 "AT3G08920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94A65STR14_ARATHNo assigned EC number0.61630.87790.6741yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_XV0080
hypothetical protein (239 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 1e-09
pfam00581106 pfam00581, Rhodanese, Rhodanese-like domain 5e-09
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 2e-07
COG0607110 COG0607, PspE, Rhodanese-related sulfurtransferase 2e-06
cd0152490 cd01524, RHOD_Pyr_redox, Member of the Rhodanese H 5e-04
cd01526122 cd01526, RHOD_ThiF, Member of the Rhodanese Homolo 7e-04
cd01521110 cd01521, RHOD_PspE2, Member of the Rhodanese Homol 8e-04
PRK11784 345 PRK11784, PRK11784, tRNA 2-selenouridine synthase; 0.002
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information 
 Score = 52.3 bits (126), Expect = 1e-09
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 99  EALRLQKENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWDIAR 147
           E   L  + + V+LDVR   E+   H PGAIN+ +  L +     ++ +
Sbjct: 1   ELKELLDDEDAVLLDVREPEEYAAGHIPGAINIPLSELEERAALLELDK 49

The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins. Length = 89
>gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain Back     alignment and domain information
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|238782 cd01524, RHOD_Pyr_redox, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|238784 cd01526, RHOD_ThiF, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|238779 cd01521, RHOD_PspE2, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|236982 PRK11784, PRK11784, tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 172
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.54
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.33
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.29
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.18
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 99.07
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 98.99
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 98.98
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 98.96
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 98.94
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 98.91
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 98.88
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 98.84
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 98.83
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 98.82
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 98.82
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 98.81
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 98.8
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 98.78
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 98.77
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 98.76
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 98.75
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 98.73
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 98.69
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 98.68
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 98.67
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 98.63
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 98.59
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 98.58
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 98.5
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 98.44
PRK07411390 hypothetical protein; Validated 98.43
PRK01415247 hypothetical protein; Validated 98.42
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 98.4
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 98.4
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 98.36
PLN02160136 thiosulfate sulfurtransferase 98.35
PRK05320257 rhodanese superfamily protein; Provisional 98.34
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 98.32
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 98.27
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 98.26
PRK11493 281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 98.23
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 98.21
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 98.21
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 98.2
PRK05600370 thiamine biosynthesis protein ThiF; Validated 98.17
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 98.17
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 98.14
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 98.11
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 98.1
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 98.1
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 98.01
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 97.92
PLN02723 320 3-mercaptopyruvate sulfurtransferase 97.9
KOG3772325 consensus M-phase inducer phosphatase [Cell cycle 97.82
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 97.81
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 97.43
COG1054 308 Predicted sulfurtransferase [General function pred 96.63
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 96.58
COG2897 285 SseA Rhodanese-related sulfurtransferase [Inorgani 96.54
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 95.93
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 94.32
COG2603 334 Predicted ATPase [General function prediction only 93.78
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 90.62
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 89.59
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 89.22
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 88.76
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 87.98
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 85.48
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 83.89
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 83.24
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 80.7
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 80.25
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=99.54  E-value=1.6e-15  Score=129.70  Aligned_cols=111  Identities=18%  Similarity=0.216  Sum_probs=79.7

Q ss_pred             CCCCceecCCCCc-cccceeeeeeecccCeeeecccccCCceeeeecccCCCCCCchhhHHHHHHHHhhc-CCCcccHHH
Q 030741           22 RSSPLILAPKTNQ-DTTICCLTVRSFTFSRRRLSSQSVPRGLIIQNAATKPAKSPAEEDWKTKRELLLQK-RVRSVEAKE   99 (172)
Q Consensus        22 ~~~~~~~~~~~~~-~~~~~~~~~r~~g~~~~~~~~g~~~~GL~~~~~~~~p~~s~~~~~~~~~~~~~~~~-~~~~Is~~e   99 (172)
                      +...+|.|-+.+. .++|+||++|++||++|++|+|    |+..|..++.|....... . ....+..+. .-..++.++
T Consensus        89 ~d~tVVvYdd~~~~~A~ra~W~l~~~Gh~~V~iLdG----G~~~W~~~g~p~~~~~~~-~-~~~~f~~~~~~~~~~~~~~  162 (285)
T COG2897          89 NDDTVVVYDDGGGFFAARAWWLLRYLGHENVRILDG----GLPAWKAAGLPLETEPPE-P-PPTTFSAKYNVKAVVDATL  162 (285)
T ss_pred             CCCEEEEECCCCCeehHHHHHHHHHcCCCceEEecC----CHHHHHHcCCCccCCCCC-C-CCccccccCCccccCCHHH
Confidence            4456788887666 9999999999999999999999    666665554443321000 0 000111111 112467788


Q ss_pred             HHHHhcCCCeEEEEeCChhhhhh----------CCCCCcEeechhhHHh
Q 030741          100 ALRLQKENNFVILDVRPEAEFKE----------AHPPGAINVQIYRLIK  138 (172)
Q Consensus       100 l~~~l~~~~~~lIDVR~~~Ey~~----------ghIPgAinIP~~~l~~  138 (172)
                      ++..++.+..+|||+|++++|..          ||||||+|||+.++.+
T Consensus       163 ~~~~~~~~~~~liDaR~~~rf~G~~~ep~~~~~GHIPGAiNipw~~~~~  211 (285)
T COG2897         163 VADALEVPAVLLIDARSPERFRGKEPEPRDGKAGHIPGAINIPWTDLVD  211 (285)
T ss_pred             HHHHhcCCCeEEEecCCHHHhCCCCCCCCCCCCCCCCCCcCcCHHHHhc
Confidence            88877777889999999999987          9999999999998876

>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 8e-10
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 6e-09
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 5e-06
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 7e-06
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 4e-05
1tq1_A129 AT5G66040, senescence-associated family protein; C 1e-08
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 1e-08
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 2e-08
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 2e-08
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 2e-08
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 6e-08
1vee_A134 Proline-rich protein family; hypothetical protein, 9e-08
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 1e-07
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 2e-07
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 4e-07
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 9e-07
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 1e-06
3foj_A100 Uncharacterized protein; protein SSP1007, structur 1e-06
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 1e-06
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 2e-06
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 2e-06
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 4e-06
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 8e-06
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 2e-05
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 2e-05
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 3e-05
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 4e-05
2jtq_A85 Phage shock protein E; solution structure rhodanes 4e-05
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 8e-05
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 2e-04
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 2e-04
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 4e-04
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 6e-04
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 8e-04
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 8e-04
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 9e-04
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 Back     alignment and structure
 Score = 53.8 bits (129), Expect = 8e-10
 Identities = 10/44 (22%), Positives = 22/44 (50%)

Query: 88  LQKRVRSVEAKEALRLQKENNFVILDVRPEAEFKEAHPPGAINV 131
           + + +  + + + L L +  N  I+DVR E    + H  G+++ 
Sbjct: 23  MARSISYITSTQLLPLHRRPNIAIIDVRDEERNYDGHIAGSLHY 66
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134 Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Length = 152 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Length = 153 Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Length = 157 Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Length = 169 Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Length = 161 Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Length = 158 Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Length = 142 Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Length = 230 Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Length = 157 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.39
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.36
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.36
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.35
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.35
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.29
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.28
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.26
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.25
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.23
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.19
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.16
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.16
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.13
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.11
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.1
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.07
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.06
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.05
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.03
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.02
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.01
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 98.99
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 98.98
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 98.97
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 98.96
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 98.94
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 98.91
1tq1_A129 AT5G66040, senescence-associated family protein; C 98.9
3r2u_A466 Metallo-beta-lactamase family protein; structural 98.9
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 98.89
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 98.89
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 98.87
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 98.86
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 98.85
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 98.81
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 98.81
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 98.81
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 98.79
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 98.78
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 98.77
3op3_A216 M-phase inducer phosphatase 3; structural genomics 98.76
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 98.75
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 98.72
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 98.72
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 98.66
2jtq_A85 Phage shock protein E; solution structure rhodanes 98.61
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 98.59
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 98.55
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 98.48
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.48
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 98.41
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 98.4
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 98.4
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 98.38
1vee_A134 Proline-rich protein family; hypothetical protein, 98.34
1rhs_A 296 Sulfur-substituted rhodanese; transferase, sulfurt 98.33
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.31
3olh_A 302 MST, 3-mercaptopyruvate sulfurtransferase; structu 98.31
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 98.16
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 97.97
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 97.94
3r2u_A 466 Metallo-beta-lactamase family protein; structural 97.58
3utn_X 327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 96.88
1v8c_A168 MOAD related protein; riken structural genomics/pr 93.89
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 91.7
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 90.62
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 89.21
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 88.87
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 88.44
3foj_A100 Uncharacterized protein; protein SSP1007, structur 87.58
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 87.37
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 86.77
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 86.69
2f46_A156 Hypothetical protein; structural genomics, joint c 85.7
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 85.0
1tq1_A129 AT5G66040, senescence-associated family protein; C 84.6
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 82.14
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 80.22
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.39  E-value=1e-14  Score=125.40  Aligned_cols=110  Identities=16%  Similarity=0.228  Sum_probs=71.7

Q ss_pred             CCCCceecCCCCc-cccceeeeeeecccCeeeecccc---cCCceeeeeccc--CCCC--CCchhhHHHHHHHHhhcCCC
Q 030741           22 RSSPLILAPKTNQ-DTTICCLTVRSFTFSRRRLSSQS---VPRGLIIQNAAT--KPAK--SPAEEDWKTKRELLLQKRVR   93 (172)
Q Consensus        22 ~~~~~~~~~~~~~-~~~~~~~~~r~~g~~~~~~~~g~---~~~GL~~~~~~~--~p~~--s~~~~~~~~~~~~~~~~~~~   93 (172)
                      ..+++|.|.+.+. .++|+||+||++||++|+||+|.   ...|+.+.....  .++.  ......... ..      -.
T Consensus       112 ~d~~VVvYD~~~~~~AaR~wW~Lr~~Gh~~V~vLdGg~aW~~~g~p~~~~~~~~~~p~p~~~~~~~~~~-~~------~~  184 (327)
T 3utn_X          112 KDDILVVYDRVGNFSSPRCAWTLGVMGHPKVYLLNNFNQYREFKYPLDSSKVAAFSPYPKSHYESSESF-QD------KE  184 (327)
T ss_dssp             TTCEEEEECSSSSSSHHHHHHHHHHTTCSEEEEESCHHHHHHTTCCCBCCCCSCSCSSCCCCCCCSCCC-HH------HH
T ss_pred             CCCEEEEEeCCCCcHHHHHHHHHHHcCCCceeecccHHHHHHhCCCcccCCccCcCCcCCccccccccc-Cc------hh
Confidence            3456888877665 89999999999999999999982   223443332210  0010  000000000 00      01


Q ss_pred             cccHHHHHHHhcCC----CeEEEEeCChhhhh-----------hCCCCCcEeechhhHHh
Q 030741           94 SVEAKEALRLQKEN----NFVILDVRPEAEFK-----------EAHPPGAINVQIYRLIK  138 (172)
Q Consensus        94 ~Is~~el~~~l~~~----~~~lIDVR~~~Ey~-----------~ghIPgAinIP~~~l~~  138 (172)
                      .++.+++.+.++++    +.+|||+|++.+|.           .||||||+|+|+.++..
T Consensus       185 v~~~~~v~~~v~~~~~~~~~~lvDaRs~~rf~G~~~ep~~~~r~GHIPGA~nlP~~~~ld  244 (327)
T 3utn_X          185 IVDYEEMFQLVKSGELAKKFNAFDARSLGRFEGTEPEPRSDIPSGHIPGTQPLPYGSLLD  244 (327)
T ss_dssp             EECHHHHHHHHHTTCHHHHCEEEECSCHHHHHTSSCCSSSSCCCCBCTTEEECCGGGGSC
T ss_pred             eecHHHHhhhhhcccccccceeeccCccceecccccCccccccCCCCCCCcccChhhccC
Confidence            36788887776543    47899999999995           49999999999988753
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 172
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 1e-07
d1gmxa_108 c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia 9e-07
d1yt8a2101 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase P 2e-06
d1hzma_154 c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat 2e-06
d1yt8a4130 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase 5e-06
d2gwfa1135 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h 2e-05
d1yt8a1136 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase 2e-05
d1c25a_161 c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9e-05
d1yt8a3157 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase 2e-04
d1e0ca1135 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter 3e-04
d1uara2141 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus th 5e-04
d1qxna_137 c.46.1.3 (A:) Polysulfide-sulfur transferase (sulf 6e-04
d1ymka1174 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) 8e-04
d1e0ca2136 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacte 0.003
d1uara1143 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus ther 0.003
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 46.0 bits (108), Expect = 1e-07
 Identities = 16/55 (29%), Positives = 20/55 (36%), Gaps = 1/55 (1%)

Query: 90  KRVRSVEAKEALRLQKENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWTAWD 144
           +   SV    A  L        LDVR   EF + H  GAINV          + +
Sbjct: 5   RVPSSVSVTVAHDLLLAG-HRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKN 58
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 101 Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 157 Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 135 Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 141 Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Length = 137 Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 136 Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 143 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.15
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.15
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.01
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.0
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 98.99
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 98.94
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 98.94
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 98.92
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 98.81
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 98.78
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 98.72
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 98.66
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 98.62
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 98.61
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 98.51
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 98.44
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 98.41
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 98.37
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 98.33
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 98.1
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 97.98
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 97.45
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 97.3
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 97.18
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 96.46
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 95.07
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 95.0
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 94.55
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 94.47
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 93.21
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 89.34
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 83.73
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 82.89
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Sulfurtransferase GlpE
species: Escherichia coli [TaxId: 562]

Probab=99.15  E-value=1.5e-11  Score=87.25  Aligned_cols=51  Identities=18%  Similarity=0.223  Sum_probs=46.2

Q ss_pred             CCCcccHHHHHHHhcCCCeEEEEeCChhhhhhCCCCCcEeechhhHHhhhh
Q 030741           91 RVRSVEAKEALRLQKENNFVILDVRPEAEFKEAHPPGAINVQIYRLIKEWT  141 (172)
Q Consensus        91 ~~~~Is~~el~~~l~~~~~~lIDVR~~~Ey~~ghIPgAinIP~~~l~~~~~  141 (172)
                      .++.|+++|+.+++++++++|||||++.||..||||||+|+|..++.+.+.
T Consensus         3 ~~~~Is~~e~~~~l~~~~~~liDvR~~~e~~~ghI~gA~~ip~~~l~~~~~   53 (108)
T d1gmxa_           3 QFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGAFMR   53 (108)
T ss_dssp             SCEEECHHHHHHHHHTTCCEEEECSCHHHHHHCEETTCEECCHHHHHHHHH
T ss_pred             CCCEeCHHHHHHHHHCCCeEEEECCCHHHHHhcCCCCcccccchhHHHHhh
Confidence            356799999999998888999999999999999999999999999887655
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure