Citrus Sinensis ID: 030757


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MPPPQRYQHYDDVDVHRRHDSPPLPPKPNPKILPILLKVIIMTLITSMFFLLLGLVAFLLLPILFTSLNRHHDRHRGACHSDGLSPKELKSLSQFKISKRNESQPGFESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCRTPTTFDRFLRNSFYSIWEN
cccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHcccccEEEEccccccccccccccccccccccccEEEcccccccccccccHHHHHccccccccccccccccccccccccccccc
*******************************ILPILLKVIIMTLITSMFFLLLGLVAFLLLPILFTSLNRH*****************LKSLSQFKISK********ESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCRTPTTFDRFLRNSFYSIW**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPPQRYQHYDDVDVHRRHDSPPLPPKPNPKILPILLKVIIMTLITSMFFLLLGLVAFLLLPILFTSLNRHHDRHRGACHSDGLSPKELKSLSQFKISKRNESQPGFESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCRTPTTFDRFLRNSFYSIWEN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RING-H2 finger protein ATL56 probableQ9ZV51

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X4J, chain A
Confidence level:very confident
Coverage over the Query: 89-159
View the alignment between query and template
View the model in PyMOL
Template: 4EPO, chain C
Confidence level:probable
Coverage over the Query: 110-155
View the alignment between query and template
View the model in PyMOL