Citrus Sinensis ID: 030757

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MPPPQRYQHYDDVDVHRRHDSPPLPPKPNPKILPILLKVIIMTLITSMFFLLLGLVAFLLLPILFTSLNRHHDRHRGACHSDGLSPKELKSLSQFKISKRNESQPGFESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCRTPTTFDRFLRNSFYSIWEN
cccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHcccccEEEEccccccccccccccccccccccccEEEcccccccccccccHHHHHccccccccccccccccccccccccccccc
ccccHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHccEEEEEccccccccccccEEEEHHHcccccEEEEcccccccccHHHHHHHHHcccccccccccccccccccccHHHHHcc
mpppqryqhyddvdvhrrhdspplppkpnpkilPILLKVIIMTLITSMFFLLLGLVAFLLLPILFtslnrhhdrhrgachsdglspkeLKSLSQFKIskrnesqpgfeseCVVCLegfkqgqwcrklvgcghvfhrKCLDTWLLkvaacptcrtpttfdrflRNSFYSIWEN
mpppqryqhyddvdvhrrhdspplppkpnpkiLPILLKVIIMTLITSMFFLLLGLVAFLLLPILFTSLNRHHDRHRgachsdglspkELKSLSQFKISKrnesqpgfESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAacptcrtpttfdrflRNSFYSIWEN
MPPPQRYQHYddvdvhrrhdSpplppkpnpkilpillkviiMTLITSMfflllglvaflllpilfTSLNRHHDRHRGACHSDGLSPKELKSLSQFKISKRNESQPGFESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCRTPTTFDRFLRNSFYSIWEN
*******************************ILPILLKVIIMTLITSMFFLLLGLVAFLLLPILFTSLNRH*************************************SECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCRTPTTFDRFLRNSFYSIW**
***********************************LLKVIIMTLITSMFFLLLGLVAFLLLPILF***********************LKSLSQFKISK********ESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCRTPTTFDRF***********
MPPPQRYQHYDDVDVHRRHDSPPLPPKPNPKILPILLKVIIMTLITSMFFLLLGLVAFLLLPILFTSLNRHHDRHRGACHSDGLSPKELKSLSQFKIS*********ESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCRTPTTFDRFLRNSFYSIWEN
*********************PPLPPKPNPKILPILLKVIIMTLITSMFFLLLGLVAFLLLPILFTSLNRHH*********DGLSPKELKSLSQFKISKRNESQPGFESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCRTPTTFDRFLRNSFYSIWEN
ooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPPQRYQHYDDVDVHRRHDSPPLPPKPNPKILPILLKVIIMTLITSMFFLLLGLVAFLLLPILFTSLNRHHDRHRGACHSDGLSPKELKSLSQFKISKRNESQPGFESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCRTPTTFDRFLRNSFYSIWEN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query172 2.2.26 [Sep-21-2011]
Q9ZV51181 RING-H2 finger protein AT yes no 0.738 0.701 0.519 3e-23
Q9M0C3176 RING-H2 finger protein AT no no 0.813 0.795 0.401 3e-21
O22755185 RING-H2 finger protein AT no no 0.773 0.718 0.312 3e-11
Q9SLC3236 E3 ubiquitin-protein liga no no 0.755 0.550 0.294 4e-11
P93823 381 RING-H2 finger protein AT no no 0.715 0.322 0.316 6e-10
Q8L9W3163 E3 ubiquitin-protein liga no no 0.639 0.674 0.349 6e-10
Q8LC69185 RING-H2 finger protein AT no no 0.656 0.610 0.35 1e-09
Q9SJJ7237 RING-H2 finger protein AT no no 0.424 0.308 0.355 2e-09
Q9M0R7132 RING-H2 finger protein AT no no 0.418 0.545 0.410 3e-09
Q9LM69197 RING-H2 finger protein AT no no 0.703 0.614 0.312 6e-09
>sp|Q9ZV51|ATL56_ARATH RING-H2 finger protein ATL56 OS=Arabidopsis thaliana GN=ATL56 PE=2 SV=1 Back     alignment and function desciption
 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 68/131 (51%), Positives = 91/131 (69%), Gaps = 4/131 (3%)

Query: 27  KPNPKILPILLKVIIMTLITSMFFLLLGLVAFLLLPILFTSLNRHHDRHRGAC---HSDG 83
           KP  +IL + L  +IM  I  +F +L+G+ + L+LP+L +SL+RHH R R       SDG
Sbjct: 24  KPKTRILSLFLVGVIMFSIFFLFLVLIGIASVLILPLLLSSLHRHHRRRRRNRRQESSDG 83

Query: 84  LSPKELKSLSQFKISKRNESQPGFESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWL 143
           LS + +K L QFK S+ + +   +ES+CVVC +GF+QGQWCR L GCGHVFHRKC+DTWL
Sbjct: 84  LSSRFVKKLPQFKFSEPS-TYTRYESDCVVCFDGFRQGQWCRNLPGCGHVFHRKCVDTWL 142

Query: 144 LKVAACPTCRT 154
           LK + CP CR 
Sbjct: 143 LKASTCPICRA 153

Arabidopsis thaliana (taxid: 3702)
>sp|Q9M0C3|ATL14_ARATH RING-H2 finger protein ATL14 OS=Arabidopsis thaliana GN=ATL14 PE=2 SV=1 Back     alignment and function description
>sp|O22755|ATL44_ARATH RING-H2 finger protein ATL44 OS=Arabidopsis thaliana GN=ATL44 PE=2 SV=1 Back     alignment and function description
>sp|Q9SLC3|ATL41_ARATH E3 ubiquitin-protein ligase ATL41 OS=Arabidopsis thaliana GN=ATL41 PE=1 SV=1 Back     alignment and function description
>sp|P93823|ATL1_ARATH RING-H2 finger protein ATL1 OS=Arabidopsis thaliana GN=ATL1 PE=2 SV=1 Back     alignment and function description
>sp|Q8L9W3|ATL23_ARATH E3 ubiquitin-protein ligase ATL23 OS=Arabidopsis thaliana GN=ATL23 PE=1 SV=2 Back     alignment and function description
>sp|Q8LC69|ATL8_ARATH RING-H2 finger protein ATL8 OS=Arabidopsis thaliana GN=ATL8 PE=2 SV=2 Back     alignment and function description
>sp|Q9SJJ7|ATL57_ARATH RING-H2 finger protein ATL57 OS=Arabidopsis thaliana GN=ATL57 PE=2 SV=1 Back     alignment and function description
>sp|Q9M0R7|ATL39_ARATH RING-H2 finger protein ATL39 OS=Arabidopsis thaliana GN=ATL39 PE=2 SV=1 Back     alignment and function description
>sp|Q9LM69|ATL80_ARATH RING-H2 finger protein ATL80 OS=Arabidopsis thaliana GN=ATL80 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
224143836170 predicted protein [Populus trichocarpa] 0.843 0.852 0.496 8e-32
349891714174 RING-H2 zinc finger protein [Manihot esc 0.860 0.850 0.521 9e-32
224143833171 predicted protein [Populus trichocarpa] 0.843 0.847 0.483 3e-30
357479885182 RING finger-like protein [Medicago trunc 0.784 0.741 0.517 3e-24
449462739178 PREDICTED: RING-H2 finger protein ATL56- 0.75 0.724 0.430 9e-24
224088388136 predicted protein [Populus trichocarpa] 0.703 0.889 0.52 2e-23
388493108182 unknown [Medicago truncatula] 0.784 0.741 0.510 6e-23
255585011166 RING-H2 finger protein ATL2A, putative [ 0.639 0.662 0.547 1e-22
15224210181 RING-H2 finger protein ATL56 [Arabidopsi 0.738 0.701 0.519 1e-21
227202782173 AT2G18670 [Arabidopsis thaliana] 0.738 0.734 0.519 2e-21
>gi|224143836|ref|XP_002325091.1| predicted protein [Populus trichocarpa] gi|222866525|gb|EEF03656.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 75/151 (49%), Positives = 97/151 (64%), Gaps = 6/151 (3%)

Query: 25  PPKPNPKILPILLKVIIMTLITSMFFLLLGLVAFLLLPILFTSLNRHHDRHRGACHSDGL 84
           PPKPN + L ++LK IIMT IT  FFL LG+ A LLL    ++L+RH      +     L
Sbjct: 18  PPKPNQEFLSLILKAIIMTAITIFFFLFLGVAAILLL-FATSALHRHSTTSSNS--PKAL 74

Query: 85  SPKELKSLSQFKISKRNESQPGF-ESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWL 143
             KELK L +F+ S +   + G  +S CVVCLE  KQGQWCR LVGCGHVFHRKC+D WL
Sbjct: 75  PLKELKKLPRFRFSTKTRPETGADQSSCVVCLEEIKQGQWCRNLVGCGHVFHRKCVDAWL 134

Query: 144 LKVAACPTCRTPTTFDRFLRNS--FYSIWEN 172
           +KV+ACP CRT    D+ +++   +  +W N
Sbjct: 135 VKVSACPICRTRVELDQGVKDRPLWDFVWRN 165

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|349891714|gb|AEQ20638.1| RING-H2 zinc finger protein [Manihot esculenta] Back     alignment and taxonomy information
>gi|224143833|ref|XP_002325090.1| predicted protein [Populus trichocarpa] gi|222866524|gb|EEF03655.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357479885|ref|XP_003610228.1| RING finger-like protein [Medicago truncatula] gi|355511283|gb|AES92425.1| RING finger-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449462739|ref|XP_004149098.1| PREDICTED: RING-H2 finger protein ATL56-like [Cucumis sativus] gi|449507961|ref|XP_004163179.1| PREDICTED: RING-H2 finger protein ATL56-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224088388|ref|XP_002308436.1| predicted protein [Populus trichocarpa] gi|222854412|gb|EEE91959.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388493108|gb|AFK34620.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255585011|ref|XP_002533216.1| RING-H2 finger protein ATL2A, putative [Ricinus communis] gi|223526973|gb|EEF29169.1| RING-H2 finger protein ATL2A, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15224210|ref|NP_179457.1| RING-H2 finger protein ATL56 [Arabidopsis thaliana] gi|75339071|sp|Q9ZV51.1|ATL56_ARATH RecName: Full=RING-H2 finger protein ATL56 gi|4185133|gb|AAD08936.1| putative RING zinc finger protein [Arabidopsis thaliana] gi|15450663|gb|AAK96603.1| At2g18670/MSF3.5 [Arabidopsis thaliana] gi|20466087|gb|AAM19965.1| At2g18670/MSF3.5 [Arabidopsis thaliana] gi|66865918|gb|AAY57593.1| RING finger family protein [Arabidopsis thaliana] gi|330251697|gb|AEC06791.1| RING-H2 finger protein ATL56 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|227202782|dbj|BAH56864.1| AT2G18670 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
TAIR|locus:2053994181 AT2G18670 [Arabidopsis thalian 0.505 0.480 0.582 1.8e-25
TAIR|locus:2118651176 AT4G30370 [Arabidopsis thalian 0.476 0.465 0.576 1.4e-23
TAIR|locus:2074678158 AT3G11110 [Arabidopsis thalian 0.465 0.506 0.370 5.6e-13
TAIR|locus:2178788 308 ATL63 "TOXICOS EN LEVADURA 63" 0.418 0.233 0.410 7.9e-12
TAIR|locus:4010713762223 AT3G20395 [Arabidopsis thalian 0.389 0.300 0.408 8.2e-12
TAIR|locus:2057861237 AT2G27940 [Arabidopsis thalian 0.424 0.308 0.355 1.7e-11
TAIR|locus:2053863185 RHA3A "RING-H2 finger A3A" [Ar 0.453 0.421 0.395 2.2e-11
TAIR|locus:2122348132 AT4G09100 [Arabidopsis thalian 0.412 0.537 0.416 2.8e-11
TAIR|locus:2053791236 AT2G42360 [Arabidopsis thalian 0.465 0.338 0.370 3.5e-11
TAIR|locus:2825708197 AT1G20823 [Arabidopsis thalian 0.436 0.380 0.407 3.5e-11
TAIR|locus:2053994 AT2G18670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 289 (106.8 bits), Expect = 1.8e-25, P = 1.8e-25
 Identities = 53/91 (58%), Positives = 66/91 (72%)

Query:    66 TSLNRHHDRHRGACH---SDGLSPKELKSLSQFKISKRNESQPGFESECVVCLEGFKQGQ 122
             +SL+RHH R R       SDGLS + +K L QFK S+ + +   +ES+CVVC +GF+QGQ
Sbjct:    63 SSLHRHHRRRRRNRRQESSDGLSSRFVKKLPQFKFSEPS-TYTRYESDCVVCFDGFRQGQ 121

Query:   123 WCRKLVGCGHVFHRKCLDTWLLKVAACPTCR 153
             WCR L GCGHVFHRKC+DTWLLK + CP CR
Sbjct:   122 WCRNLPGCGHVFHRKCVDTWLLKASTCPICR 152
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2118651 AT4G30370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074678 AT3G11110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178788 ATL63 "TOXICOS EN LEVADURA 63" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713762 AT3G20395 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057861 AT2G27940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053863 RHA3A "RING-H2 finger A3A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122348 AT4G09100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053791 AT2G42360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825708 AT1G20823 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZV51ATL56_ARATHNo assigned EC number0.51900.73830.7016yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00180885
hypothetical protein (170 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 3e-12
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-10
cd0016245 cd00162, RING, RING-finger (Really Interesting New 3e-09
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-07
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 3e-06
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 4e-05
smart0018440 smart00184, RING, Ring finger 1e-04
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 2e-04
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 5e-04
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 0.003
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 58.2 bits (141), Expect = 3e-12
 Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 110 ECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCRTP 155
           EC +CL+ F+ G+    L  CGHVFH++CLD WL     CP CR P
Sbjct: 2   ECPICLDEFEPGEEVVVL-PCGHVFHKECLDKWLRSSNTCPLCRAP 46

Length = 46
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 172
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.78
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.59
PHA02929238 N1R/p28-like protein; Provisional 99.52
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.36
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.36
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.34
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.29
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.23
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.17
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.17
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.15
PHA02926242 zinc finger-like protein; Provisional 99.14
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 99.11
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.06
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.04
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 99.01
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 99.01
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.95
PF1463444 zf-RING_5: zinc-RING finger domain 98.93
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.93
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.85
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.83
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.75
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.72
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.69
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.62
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.61
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.59
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.54
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.47
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.46
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.44
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.41
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.41
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.39
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.3
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.26
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.21
COG52191525 Uncharacterized conserved protein, contains RING Z 98.21
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.1
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.06
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 98.04
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.02
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.95
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.94
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.91
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.75
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.64
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.58
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.56
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 97.5
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.48
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.44
KOG3039303 consensus Uncharacterized conserved protein [Funct 97.32
KOG1941518 consensus Acetylcholine receptor-associated protei 97.26
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.25
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 97.21
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 97.16
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.16
COG5152259 Uncharacterized conserved protein, contains RING a 97.06
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.0
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.8
KOG2660 331 consensus Locus-specific chromosome binding protei 96.8
PF04641260 Rtf2: Rtf2 RING-finger 96.77
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.72
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.64
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 96.58
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 96.56
PHA02825162 LAP/PHD finger-like protein; Provisional 96.54
PHA02862156 5L protein; Provisional 96.5
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.47
KOG4739 233 consensus Uncharacterized protein involved in syna 96.46
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 96.45
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.45
KOG1002 791 consensus Nucleotide excision repair protein RAD16 96.38
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.34
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.29
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 96.27
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 96.12
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.09
KOG1940276 consensus Zn-finger protein [General function pred 95.94
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 95.88
PHA03096284 p28-like protein; Provisional 95.78
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.74
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.74
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 94.98
COG5175 480 MOT2 Transcriptional repressor [Transcription] 94.87
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 94.78
KOG3002 299 consensus Zn finger protein [General function pred 94.61
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 94.6
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 94.53
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 94.42
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 94.05
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 93.89
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 93.19
COG5222427 Uncharacterized conserved protein, contains RING Z 92.82
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 92.43
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 92.43
KOG03091081 consensus Conserved WD40 repeat-containing protein 92.21
KOG3053 293 consensus Uncharacterized conserved protein [Funct 92.17
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 92.04
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 92.0
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 91.12
KOG0298 1394 consensus DEAD box-containing helicase-like transc 90.55
KOG3899381 consensus Uncharacterized conserved protein [Funct 90.44
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 89.9
KOG3113 293 consensus Uncharacterized conserved protein [Funct 89.64
PF10272358 Tmpp129: Putative transmembrane protein precursor; 89.35
KOG1609 323 consensus Protein involved in mRNA turnover and st 88.85
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 87.29
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 86.74
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 86.22
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 83.57
KOG4367 699 consensus Predicted Zn-finger protein [Function un 82.61
KOG0269839 consensus WD40 repeat-containing protein [Function 81.92
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.78  E-value=2.8e-19  Score=143.65  Aligned_cols=77  Identities=30%  Similarity=0.706  Sum_probs=67.1

Q ss_pred             CCCCCCCHHHHhccCccccccCCCCCCCCcccccccccccccCceeeeecCCCCcccHHHHHHHHhcCCC-CcccccCCc
Q 030757           79 CHSDGLSPKELKSLSQFKISKRNESQPGFESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAA-CPTCRTPTT  157 (172)
Q Consensus        79 ~~~~~l~~~~~~~l~~~~~~~~~~~~~~~~~~C~ICl~~~~~~~~~~~l~~C~H~fh~~Ci~~~~~~~~~-CP~CR~~~~  157 (172)
                      .+..++.++.+++++...|.+..+....  +.|+||+|+|+.++++++| ||+|.||..||+.|+.+.++ ||+||.++.
T Consensus       202 ~~~~r~~k~~l~~~p~~~f~~~~~~~~~--~~CaIClEdY~~GdklRiL-PC~H~FH~~CIDpWL~~~r~~CPvCK~di~  278 (348)
T KOG4628|consen  202 LRRNRLIKRLLKKLPVRTFTKGDDEDAT--DTCAICLEDYEKGDKLRIL-PCSHKFHVNCIDPWLTQTRTFCPVCKRDIR  278 (348)
T ss_pred             hhhhhhHHHHHhhCCcEEeccccccCCC--ceEEEeecccccCCeeeEe-cCCCchhhccchhhHhhcCccCCCCCCcCC
Confidence            4557788999999999999887665433  7999999999999999998 99999999999999998865 999999766


Q ss_pred             c
Q 030757          158 F  158 (172)
Q Consensus       158 ~  158 (172)
                      .
T Consensus       279 ~  279 (348)
T KOG4628|consen  279 T  279 (348)
T ss_pred             C
Confidence            4

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 1e-06
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 7e-05
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 7e-05
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 1e-04
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 5e-04
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure 
Iteration: 1

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/44 (47%), Positives = 26/44 (59%)
Query: 110 ECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCR 153
           EC VCL   + G+  R L  CGH FH +C+D WL   + CP CR
Sbjct: 7   ECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCR 50
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 2e-16
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 7e-16
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 1e-15
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 6e-15
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 1e-13
2ect_A78 Ring finger protein 126; metal binding protein, st 2e-13
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-13
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 5e-12
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 6e-12
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 1e-11
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 1e-11
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 6e-11
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 3e-10
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 7e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 3e-09
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 6e-09
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 7e-09
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 2e-08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 3e-08
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-07
3nw0_A238 Non-structural maintenance of chromosomes element 2e-07
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 8e-07
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 1e-06
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 1e-06
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 2e-06
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-06
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-06
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 9e-06
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 1e-05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 2e-05
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 2e-05
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 2e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 3e-05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 7e-05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 1e-04
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 1e-04
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 5e-04
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
 Score = 68.4 bits (168), Expect = 2e-16
 Identities = 21/47 (44%), Positives = 26/47 (55%)

Query: 109 SECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCRTP 155
            EC VCL   + G+  R L  CGH FH +C+D WL   + CP CR  
Sbjct: 6   VECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLT 52
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.7
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.65
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.58
2ect_A78 Ring finger protein 126; metal binding protein, st 99.58
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.58
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.56
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.55
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.54
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.54
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.51
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.48
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.48
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.46
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.45
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.44
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.43
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.43
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.41
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.4
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.39
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.39
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.39
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.38
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.38
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.37
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.37
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.37
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.36
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.36
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.35
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.33
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.32
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.3
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.28
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.27
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.27
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.25
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.25
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.24
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.23
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.23
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.21
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.18
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.18
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.17
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.17
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.17
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.13
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.12
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.12
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.1
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.08
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.03
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.03
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.0
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.97
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.96
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.93
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.89
2ea5_A68 Cell growth regulator with ring finger domain prot 98.85
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.83
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.82
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.82
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.72
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.69
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.68
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.66
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.56
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.48
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.33
3nw0_A238 Non-structural maintenance of chromosomes element 97.97
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 95.88
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 94.53
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.34
1wil_A89 KIAA1045 protein; ring finger domain, structural g 92.98
2k16_A75 Transcription initiation factor TFIID subunit 3; p 90.07
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 89.72
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 89.5
1we9_A64 PHD finger family protein; structural genomics, PH 89.35
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 88.56
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 88.09
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 88.05
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 85.69
3lqh_A 183 Histone-lysine N-methyltransferase MLL; PHD finger 85.58
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 84.79
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 84.74
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 84.72
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 83.23
3o36_A 184 Transcription intermediary factor 1-alpha; TRIM24, 82.4
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 82.37
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 81.57
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 81.52
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 81.47
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 80.8
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 80.15
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.70  E-value=3.4e-17  Score=108.59  Aligned_cols=80  Identities=25%  Similarity=0.582  Sum_probs=67.0

Q ss_pred             CCCCCCCCCHHHHhccCccccccCCCCCCCCcccccccccccccCceeeeecCCCCcccHHHHHHHHhcCCCCcccccCC
Q 030757           77 GACHSDGLSPKELKSLSQFKISKRNESQPGFESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCRTPT  156 (172)
Q Consensus        77 ~~~~~~~l~~~~~~~l~~~~~~~~~~~~~~~~~~C~ICl~~~~~~~~~~~l~~C~H~fh~~Ci~~~~~~~~~CP~CR~~~  156 (172)
                      ......+++++.++.++...+..... ..+.+..|+||++++..++.+..+ +|+|.||..|+..|+..+.+||+||..+
T Consensus        10 ~~~~~~~~s~~~i~~lp~~~~~~~~~-~~~~~~~C~IC~~~~~~~~~~~~l-~C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~   87 (91)
T 2l0b_A           10 HMVANPPASKESIDALPEILVTEDHG-AVGQEMCCPICCSEYVKGDVATEL-PCHHYFHKPCVSIWLQKSGTCPVCRCMF   87 (91)
T ss_dssp             CSSCCCCCCHHHHHTSCEEECCTTCS-SSSSCSEETTTTEECCTTCEEEEE-TTTEEEEHHHHHHHHTTTCBCTTTCCBS
T ss_pred             CCcCCCCCCHHHHHhCCCeeeccccc-ccCCCCCCcccChhhcCCCcEEec-CCCChHHHHHHHHHHHcCCcCcCcCccC
Confidence            34466789999999999888765432 234667899999999988877777 8999999999999999989999999988


Q ss_pred             cc
Q 030757          157 TF  158 (172)
Q Consensus       157 ~~  158 (172)
                      ..
T Consensus        88 ~~   89 (91)
T 2l0b_A           88 PP   89 (91)
T ss_dssp             SC
T ss_pred             CC
Confidence            64
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 172
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 3e-15
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 7e-11
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 3e-09
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 2e-08
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 4e-08
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 7e-08
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-07
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 1e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-06
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 5e-06
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 8e-06
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 3e-05
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 3e-04
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 0.002
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 64.1 bits (156), Expect = 3e-15
 Identities = 21/48 (43%), Positives = 26/48 (54%)

Query: 108 ESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCRTP 155
             EC VCL   + G+  R L  CGH FH +C+D WL   + CP CR  
Sbjct: 5   GVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLT 52
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.72
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.58
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.54
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.53
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.5
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.45
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.38
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.33
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.31
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.27
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.18
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.17
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.16
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.16
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.91
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.49
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 94.57
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 93.3
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 92.84
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 89.86
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 87.2
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 84.33
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 82.08
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 81.35
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 80.85
d1wema_76 Death associated transcription factor 1, Datf1 (DI 80.22
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.72  E-value=9.7e-19  Score=103.93  Aligned_cols=51  Identities=41%  Similarity=0.891  Sum_probs=46.3

Q ss_pred             CcccccccccccccCceeeeecCCCCcccHHHHHHHHhcCCCCcccccCCc
Q 030757          107 FESECVVCLEGFKQGQWCRKLVGCGHVFHRKCLDTWLLKVAACPTCRTPTT  157 (172)
Q Consensus       107 ~~~~C~ICl~~~~~~~~~~~l~~C~H~fh~~Ci~~~~~~~~~CP~CR~~~~  157 (172)
                      ++.+|+||+++|..++.+..+++|+|.||.+|+.+|++.+.+||+||.++.
T Consensus         4 d~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            456799999999999888888789999999999999999999999999874
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure