Citrus Sinensis ID: 030794

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MAKSQASLLLQKQLKDLCKNPVDGFSAGLVDESNVFEWSVSIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTPVHTAASVWRSLSPGVLNYAWFLMNAGYEYGNTLHSCFLSVHSVACHLMAVVIGSESWW
ccHHHHHHHHHHHHHHHHccccccCEEEEcccccEEEEEEEEEccccccccccEEEEEEEccccccccccEEEECcccccccccccccEEEEccccccccccccccccccccccccccEEEEECccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccEEEEcccccc
*****AS***QKQLKDLCKNPVDGFSAGLVDESNVFEWSVSIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTPVHTAASVWRSLSPGVLNYAWFLMNAGYEYGNTLHSCFLSVHSVACHLMAVVIGS****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKSQASLLLQKQLKDLCKNPVDGFSAGLVDESNVFEWSVSIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTPVHTAASVWRSLSPGVLNYAWFLMNAGYEYGNTLHSCFLSVHSVACHLMAVVIGSESWW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-conjugating enzyme E2 14 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Involved in the formation of multiubiquitin chains. Signal the protein for selective degradation.probableP42747
Ubiquitin-conjugating enzyme E2 7 Catalyzes the covalent attachment of ubiquitin to other proteins. Functions in degradation of misfolded or regulated proteins localized in the endoplasmic reticulum (ER) lumen or membrane via the ubiquitin-proteasome system. Cognate E2 conjugating enzyme for the DOA10 ubiquitin ligase complex, which is part of the ERAD-C pathway responsible for the rapid degradation of membrane proteins with misfolded cytoplasmic domains, and of the HRD1 ubiquitin ligase complex, which is part of the ERAD-L and ERAD-M pathways responsible for the rapid degradation of soluble lumenal and membrane proteins with misfolded lumenal domains (ERAD-L), or ER-membrane proteins with misfolded transmembrane domains (ERAD-M). Involved in resistance to cadmium poisoning.probableQ02159
Ubiquitin-conjugating enzyme E2 7 Catalyzes the covalent attachment of ubiquitin to other proteins so as to signal them for selective protein degradation. Involved in the formation of multiubiquitin chains.probableP25868

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RZ3, chain A
Confidence level:very confident
Coverage over the Query: 3-94,109-158
View the alignment between query and template
View the model in PyMOL