Citrus Sinensis ID: 030795


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MAAMNSSVLACNYAISGSAGSSELNAKIVSVSTPAVHGHKMPVIRAQQVDVSKESRGTDGRRAAMALLAVTLFTTATAAASSSANAGVIDEYLERSKANKELNDQKRLATSGANFARAYTVQFGTCKFPENFTGCQDLAKQKKVPFISDDLELECKGKDKYKCGSNVFWKW
cccccccHHHHHHHHccccccccccccccccccccccccccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccccHHHHHHccccccccccccEEEcccccccccccccccc
*****SS*LACNYAISGSAGSSELNAKIVSVSTPAVHGHKM*********************AAMALLAVTLFTTATAAASSSANAGVIDEY******************SGANFARAYTVQFGTCKFPENFTGCQDLAKQKKVPFISDDLELECKGKDKYKCGSNVFWKW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAMNSSVLACNYAISGSAGSSELNAKIVSVSTPAVHGHKMPVIRAQQVDVSKESRGTDGRRAAMALLAVTLFTTATAAASSSANAGVIDEYLERSKANKELNDQKRLATSGANFARAYTVQFGTCKFPENFTGCQDLAKQKKVPFISDDLELECKGKDKYKCGSNVFWKW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Photosystem I reaction center subunit N, chloroplastic May function in mediating the binding of the antenna complexes to the PSI reaction center and core antenna. Plays an important role in docking plastocyanin to the PSI complex. Does not bind pigments.confidentP49107
Photosystem I reaction center subunit N, chloroplastic May function in mediating the binding of the antenna complexes to the PSI reaction center and core antenna.probableP31093

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WSC, chain N
Confidence level:very confident
Coverage over the Query: 87-171
View the alignment between query and template
View the model in PyMOL