Citrus Sinensis ID: 030800


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLNPRVDGQRLIAAIPALTKEHIQAMCKVVAKTSEDVKQSIRRSRQKALDMMKKAGSSLPKDQMKRLEKEVDELTKKYVKSADDVCKAKEKEINEG
cHHHHHHHHHHHcccccccccccccccEEEccccccccccHHcccccccccEEEEcccccccHHHHHHHHHcccccccccccccEEEEccccccHHHHHHHHHHHHHHcccccHHHHHHcHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
***AIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLNPRVDGQRLIAAIPALTKEHIQAMCKVVAKTSEDVKQSIRRSRQKALDMMKK***********RLEKEVDELTKKYVKSADDVCKAKEKEINE*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLNPRVDGQRLIAAIPALTKEHIQAMCKVVAKTSEDVKQSIRRSRQKALDMMKKAGSSLPKDQxxxxxxxxxxxxxxxxxxxxxVCKAKEKEINEG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribosome-recycling factor Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another.probableA8MHH2
Ribosome-recycling factor Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another.probableB1MZ62
Ribosome-recycling factor Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another.probableQ3A398

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IS1, chain A
Confidence level:very confident
Coverage over the Query: 1-170
View the alignment between query and template
View the model in PyMOL